KEGG   Pseudomonas brassicacearum DF41: CD58_09400Help
Entry
CD58_09400        CDS       T03174                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
pbc  Pseudomonas brassicacearum DF41
Pathway
pbc00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pbc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CD58_09400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pbc01002]
    CD58_09400
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pbc01011]
    CD58_09400
Enzymes [BR:pbc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CD58_09400
   3.4.21  Serine endopeptidases
    3.4.21.-  
     CD58_09400
Peptidases and inhibitors [BR:pbc01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   CD58_09400
Peptidoglycan biosynthesis and degradation proteins [BR:pbc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CD58_09400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 SdpA
Motif
Other DBs
NCBI-ProteinID: AHL33099
UniProt: W8PGT2
LinkDB All DBs
Position
complement(2073454..2074920)
Genome map
AA seq 488 aa AA seqDB search
MIKSLRPLLLASLLLPLALPVTTSAATINTALSPNVQKALKASKLQDDALSLVMIPLNGP
GTPTLHNADVSVNPASTMKLVTTYAALEMLGPNHQWKTEFYTDGTLSGGILNGNLYLKGG
GDPKLNMEKLWLLMRDLRANGVQQVTGDLVLDRGFFIQPQLPEFNDDGNDENKPFLVKPD
SLLVNLKALRFVARNDGGRVLVSVEPPIASIRIENQVKAVNSKQCTGGVRYNPVPQADGS
VTVTVGGQLGDGCSSQTYLSLLDHATYTAGAVRAIWKELGGSIQGKDRLAPTPSSAKVLA
RAFSPDLAEIIRDINKYSNNTMAQQLFLSLGAQFRNEADGDDAKAAQRVVRQWLAKKGIT
APHLVMENGSGLSRAERVSAREMAAMLQAAWRSPYSAEFISSMPIAGTDGTMRKRLKTTA
MAGEAHVKTGTLNTVRAIAGFSRDINGNTWAVVAILNDPKPWGASSVLDQVLLDLYRQPK
LPQTASVL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaatctttgcgtccactgcttctggccagccttctccttcccttggccctccct
gtcaccaccagcgccgccacgatcaacaccgccctgtcgcccaacgtgcaaaaagccctc
aaggccagcaagctgcaagacgatgccctgtccctggtgatgatcccgctcaacggcccc
ggcaccccgaccctgcacaacgccgatgtctcggtgaacccggcgtccaccatgaaactg
gtgaccacctacgcagccctggaaatgctcggccccaatcaccagtggaaaaccgagttc
tacaccgacggcaccctcagcggtggcattctcaacggcaacctgtacctcaagggtggc
ggcgaccccaagctgaacatggaaaagctctggctgctgatgcgtgacctgcgggccaac
ggcgtgcagcaagtcaccggcgacctggtgctcgaccgcggttttttcatccagccgcaa
ttgcccgagttcaatgacgacggcaacgacgaaaacaaaccgttcctggtcaagcccgac
tcgctgctggtcaacctcaaggccctgcgcttcgtcgcccgcaatgacggcggccgcgtg
ctggtgtcggtggaaccgccgattgccagcatccgtatcgaaaaccaggtcaaggcggtc
aactccaagcaatgcaccggcggcgtacgctacaacccggtgccccaggcggacggcagc
gtgaccgtgaccgtcggcggccagctgggtgacggttgcagctcccagacctacctgtcg
ctgctggaccacgccacctacaccgccggtgcggtgcgggcgatctggaaagaactgggt
ggcagcatccagggcaaggaccgcctggccccgaccccgagcagcgccaaggtgctggcc
cgggcgttctcgccggacctggcggagatcatccgcgacatcaacaaatacagtaacaac
accatggcgcagcaattgttcctgagcctcggcgcgcagttccgcaacgaagccgacggt
gacgacgccaaggcggcgcaacgggtggtgcgtcagtggctggccaagaaaggcatcacc
gcgccgcacctggtgatggagaacggctccggcctgtcccgcgccgagcgggtcagcgcc
cgggaaatggccgcgatgctgcaggccgcctggcgcagcccatattcggcggagttcatc
agttcgatgccgattgccggcaccgacggcaccatgcgcaaacgcctgaagaccaccgcc
atggccggtgaagcccacgtcaagaccggcaccctgaacaccgtccgcgccatcgccggc
ttcagccgtgacatcaatggcaacacctgggcggtggtggcaatcctcaacgacccgaaa
ccctggggcgcttcgtcggtgctggaccaggtgctgctggacctgtaccgccagccaaaa
ttgccgcagacggcttcggtgctctga

DBGET integrated database retrieval system