KEGG   Pseudomonas brassicacearum DF41: CD58_09690Help
Entry
CD58_09690        CDS       T03174                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pbc  Pseudomonas brassicacearum DF41
Pathway
pbc00071  Fatty acid degradation
pbc00280  Valine, leucine and isoleucine degradation
pbc00281  Geraniol degradation
pbc00310  Lysine degradation
pbc00362  Benzoate degradation
pbc00380  Tryptophan metabolism
pbc00410  beta-Alanine metabolism
pbc00640  Propanoate metabolism
pbc00650  Butanoate metabolism
pbc00903  Limonene and pinene degradation
pbc00930  Caprolactam degradation
pbc01100  Metabolic pathways
pbc01110  Biosynthesis of secondary metabolites
pbc01120  Microbial metabolism in diverse environments
pbc01130  Biosynthesis of antibiotics
pbc01200  Carbon metabolism
pbc01212  Fatty acid metabolism
Module
pbc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CD58_09690 (fadB)
   00650 Butanoate metabolism
    CD58_09690 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CD58_09690 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CD58_09690 (fadB)
   00310 Lysine degradation
    CD58_09690 (fadB)
   00380 Tryptophan metabolism
    CD58_09690 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CD58_09690 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CD58_09690 (fadB)
   00281 Geraniol degradation
    CD58_09690 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CD58_09690 (fadB)
   00930 Caprolactam degradation
    CD58_09690 (fadB)
Enzymes [BR:pbc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CD58_09690 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CD58_09690 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CD58_09690 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     CD58_09690 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AHL33155
UniProt: W8QAE9
LinkDB All DBs
Position
2144898..2147045
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDTIKADASIKGVIVSS
GKDVFIVGADITEFVDNFKLPDAELIAGNLEANRIFSDFEDLNVPTVAAINGIALGGGLE
MCLAADYRVMSTVAKIGLPEVKLGIYPGFGGTVRLPRLIGADNAIEWIAAGKENRAEDAL
KVGAVDAVVEPGKLQEAALEMIKRAISGEFDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKTIQKAANFGRDKALEVEAAGFVKLAKTSAAQSLIGLFLNDQEL
KKKAKVYDEIARDVKQAAVLGAGIMGGGIAYQSASKGTPILMKDINEHGIEQGLAEAAKL
LVGRVDKGRMTAAKMAEVLNGIRPTLSYGDFGHVDLVVEAVVENPKVKQAVLAEVEDKVK
EDTILASNTSTISISLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSELAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKIMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDDRRSAIDVLYEAKRLGQKNGKGFYAYETDKRGKQ
KKVADSSVLEVLKPIIYEQREVTDEDIINWMMIPLCLETVRCLEDGIVETAAEADMGLVY
GIGFPPFRGGALRYIDSIGVAEFVALADQYADLGALYHPTAKLREMAKNGQRFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgaaagtggcatcgtcgaactg
aagttcgatctcaagggtgagtccgtcaacaagttcaaccgtctaaccctgaatgaattg
cgtcaggccgtggacactatcaaggcagatgcttcgatcaagggtgtgatcgtcagcagc
ggcaaggacgtcttcatcgtcggcgccgatatcaccgaattcgtcgataacttcaagctg
cccgatgccgaactgatcgctggcaacctcgaagccaaccgtattttcagcgacttcgaa
gacctcaacgtaccgaccgtcgcggccatcaacggtatcgccctgggcggcggcctggaa
atgtgcctggccgcggactaccgcgtcatgtccaccgtcgccaagatcggcctgccggaa
gtcaagctgggcatctacccaggcttcggcggtaccgtgcgcctgccgcgcctgatcggt
gccgacaacgccatcgagtggattgccgctggcaaggaaaaccgtgctgaagacgccctg
aaagtcggcgcggtggatgccgtggtcgagcctggcaaactccaggaagcggcccttgaa
atgatcaaacgcgccatcagcggcgagtttgactacaaggccaagcgtcagccgaagctg
gaaaagctcaagctcaacgcgatcgagcaaatgatggccttcgagaccgccaagggtttc
gtcgccggtcaggcaggcccgaactacccggcgccggtcgaagcgatcaagaccatccag
aaagccgcgaacttcggtcgcgacaaggccctggaagtcgaggccgcaggcttcgtcaag
ctggccaagacctcggctgcgcaaagcctgatcggtctgttcctcaatgaccaggagctg
aagaaaaaggccaaggtctacgacgaaatcgcccgtgacgtgaagcaggccgcggtactc
ggtgccggcatcatgggtggcggtatcgcctaccagtcggcgtccaaaggcacgccgatc
ctgatgaaagacatcaacgaacacggtatcgagcaaggcctggccgaagcggccaagctg
ctggtcggccgcgttgataaaggtcgcatgactgcggcgaagatggccgaagtgctcaac
ggcattcgtccaaccctgtcctacggcgattttggccatgtcgacctggtggtcgaagcg
gttgtcgagaacccgaaggtcaagcaggcggtactggctgaagtcgaagacaaggttaaa
gaggacactatcctcgcctcgaacacctcgaccatttccatttcgctgctggccaaggcc
ctcaagcgtccggaaaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggtggaagtgatccggggtgagaagtccagcgaactggccgtagccaccaccgtggcc
tacgccaagaaaatgggcaagaacccgatcgtcgtcaatgactgcccgggctttttggtc
aaccgcgtgctgttcccttacttcggcggtttcgccaagttggtcagcgctggcgtggat
ttcgtgcgcatcgacaagatcatggagaaattcggctggcccatgggcccggcgtacctg
atggacgtggtcggcatcgacaccggccaccacggtcgcgacgtcatggctgaaggcttc
ccggaccgcatgaaggacgaccgtcgttcggctatcgatgtgctctacgaagccaagcgc
ctgggtcagaagaacggcaagggcttctacgcctacgagaccgacaagcgcggcaagcaa
aagaaagtcgccgattcgtcggtgctggaagtgctcaagccgatcatctacgagcagcgt
gaagtcaccgacgaagacattatcaactggatgatgatcccgctgtgcctcgagaccgtt
cgttgcctggaagacggcattgtcgaaaccgccgccgaagccgacatgggtctggtctac
ggtatcggtttccctccattccgtggcggtgcgctgcgttacatcgattcgatcggtgtg
gccgagttcgttgccctggctgaccagtacgctgatctgggcgcgctgtaccacccgacc
gcgaagctgcgtgagatggccaagaacggccagcgtttcttcggttaa

DBGET integrated database retrieval system