KEGG   Pseudomonas brassicacearum DF41: CD58_11985Help
Entry
CD58_11985        CDS       T03174                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pbc  Pseudomonas brassicacearum DF41
Brite
KEGG Orthology (KO) [BR:pbc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CD58_11985
Enzymes [BR:pbc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CD58_11985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored DAO Thi4 FAD_binding_3 NAD_binding_7 AlaDh_PNT_C K_oxygenase Glutaredoxin FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AHL33574
UniProt: W8PI13
LinkDB All DBs
Position
2613081..2614643
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLALLKDVASLCDQITLLDNGTDAR
KPSFSLNRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIEQIRSLKGEFNF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVDERQIMAVPSIYLNGVNF
GQGRMGLEEILAKIDTSGIERQAEKISAKDAFDVLVVGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLAVALEEHVKQYDVDIMNLQRADALVAGKDGEL
HEVKFASGASLKAKTVILATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLLEFDVQLRADAVLQRKLHSLPNVTVITNAQTTEVTGDGQ
KVNGLRYKDRPSAEVRDVELEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDARGETSIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagctcagttgaagtcatacctggaacgggtcacccagccg
atcgagatcgtcgcttccctcgacgacggtgcgaaatcccaggaaatgctcgcactactc
aaagacgttgccagtctttgcgaccagattactttgctcgacaacggcaccgatgcgcgc
aagccttcgttttcgttgaatcgcccgggtgccgatatcagcctgcgctttgccggcatc
cccatgggccacgaattcacttcgctggtgctggccttgctgcaagtcggtggccaccct
tcgaaggccagtgtcgaggttatcgaacagatccgctcccttaagggcgagttcaacttc
gagacgtacttctcgctgtcatgccagaactgcccggacgtggtccaggcactgaacttg
atggcggtgctgaacccgaacattcgccacgtggcgatcgacggtgcgctgttccaggcc
gaggtcgatgaacgccagatcatggccgtgccgagcatctacttgaacggcgtgaacttc
ggccagggccgcatgggcctggaagagattctggccaagatcgacaccagcggtatcgag
cgccaggctgaaaagatcagcgccaaggacgcgttcgatgtgctggtggtgggcggtggc
ccggctggcgcttcagcggcgatctatgcggcccgtaaaggcatccgtaccggcgtggcg
gcggagcgtttcggcggccaggtgctcgacaccatggccatcgagaacttcatctcggtc
caggaaaccgaaggcccgaaactggccgttgccctggaagaacacgtcaagcagtacgac
gtggacatcatgaacctgcaacgcgccgatgcactggtggcaggcaaggatggcgagctg
cacgaagtcaagttcgccagcggtgcgagcctcaaggccaagaccgtgatcctggcgacc
ggtgcccgctggcgcgaaatgaacgtgccgggcgagcagcaatatcgcaacaagggcgtg
gcgtactgcccgcattgtgacggtccgctcttcaaaggcaagcgcgtggcggtgattggc
ggcggtaactccggcgttgaggcagccatcgacctggccggtatcgtggcccatgtgacc
ttgctggagttcgatgtgcaattgcgtgccgacgcggtgttgcagcgcaagctgcacagc
ctgccgaacgtgacggtgatcaccaacgcccagaccaccgaagtgacgggcgacgggcag
aaggtcaacggcttgcgttacaaggaccgtccaagcgctgaagtgcgcgacgtagaactg
gaagggatcttcgtgcagatcggcctgttgcccaacaccgattggctcaaaggcactgtc
gagttgtcgccgcgtggcgagatcattgtcgatgcccgaggcgaaacctcgatccctggc
gtattcgccgccggtgacgtgaccaccgtgccgtacaagcagatcgtgatcgccgtgggc
gagggggccaaggcttcgctgagcgccttcgaccatctgatccgcacctctgcgccggcc
taa

DBGET integrated database retrieval system