KEGG   Pseudomonas brassicacearum DF41: CD58_19900Help
Entry
CD58_19900        CDS       T03174                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pbc  Pseudomonas brassicacearum DF41
Pathway
pbc00500  Starch and sucrose metabolism
pbc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CD58_19900
Enzymes [BR:pbc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CD58_19900
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CD58_19900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AHL34999
UniProt: W8PLX7
LinkDB All DBs
Position
complement(4511959..4515303)
Genome map
AA seq 1114 aa AA seqDB search
MAKKPRSATFIKDPLWYKDAVIYQVHVKSYFDSNNDGIGDFPGLIEKLDYIADLGVNTIW
LLPFYPSPRRDDGYDIAEYRGVSPDYGTMADARRFIAEAHKRNLRVITELVINHTSDQHP
WFQRARKAKLGSAARDFYVWSDDDHKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVIKAVLSVMRYWLDMGIDGLRLDAIPYLIERDGTNNENLPETHDVLKQIRA
EIDANYPDRMLLAEANQWPEDTQLYFGDVDAQGLNGDECHMAFHFPLMPRMYMALAQEDR
FPITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDKERDYLWNYYAADRRARINLGIRR
RLAPLMERDRRRIELLNSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRN
GGFSRADPASLVLPPIMDPQYGYQSVNVETQAGDPHSLLNWTRRMLAVRKQSQAFGRGTL
KMLSPSNRRILAYTREYTSPEGKHEIILCVANVSRSAQAAELDLSTYAGMVPVEMLGGNA
FPPIGQLNFLLTLPPYGFYWFALATENQMPSWHVEPAQSLPDFTTLVLKKRLEELLEAPS
RTTLEQTILPSWLQNRRWFAGKDSAIEKVNIVYGVRFGDPQHPVLLSEIDVTSAGQTLRY
QLPFGLLAEDQVGAALPQQLALSRVRRVRQVGLITDAFSLESFIRAVLQGIQAGTVLPCT
EGELRFEPTEGLTALNLGAEPEVRYLSAEQSNSSVVVGGALVLKLIRKVASGVHPELEMS
AYLTAAGFSNISPLLGSVVRRDAQGEDALLMIAQGYLSNQGDAWEWTQNNLERALRDELA
DAVSEQEQHYNALGELKDFAGMLGQRLGEMHQVLAQPTDDPAFAPQATNAKEAQAIGKDV
AAQVENALRLLKQNQGQLNPSDQAMVARLLEHKKTILAHIQALAGKAVGGLRIRVHGDLH
LGQVLVIKGDAYLIDFEGEPARPLHERRGKHSPYKDVSGVLRSFDYAAAMAIHLNTVDST
ADADAARQRVADRYLEEAREAFVQAYRLAAASLAHEWKDAEGEDAALALFGLEKAAYEVA
YEAENRPAWLPVPLHGLYGLLSGLEPFSDLAGPI
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaaccccggtctgccaccttcatcaaagacccgctctggtacaaggacgcg
gtgatttatcaggttcacgttaaatcctatttcgactccaacaacgacgggatcggtgac
tttcccggcctgatcgagaagctcgactacattgccgatctcggcgtcaacaccatctgg
ctgctgccgttctatccctcgccgcggcgcgatgatggctacgacattgccgaataccgt
ggtgtgagccccgactacgggacaatggccgatgcacggcgcttcattgccgaagctcac
aagcgcaatctgcgggtcatcaccgagctggtcatcaatcacacctcggaccagcatcct
tggttccagcgggcgcgcaaggccaagctgggttcggcggcgcgggatttctacgtgtgg
tccgacgatgaccacaagtacgatggcacgcggatcattttcctcgataccgaaaaatcc
aactggacctgggacccggtggccggccagtatttctggcaccgtttctattcccatcag
cccgacctcaatttcgataatccacaggtcatcaaggctgtgctgtcggtgatgcgctac
tggctggacatgggcatcgatggcctgcgcctggacgccatcccgtacctgatcgagcgc
gacggcaccaacaacgaaaacctgcctgagactcacgacgtcctcaagcagatccgtgcc
gagatcgacgccaactaccccgaccgcatgttgctggccgaagccaaccagtggccggaa
gacacccagctgtacttcggcgatgtcgatgcccagggcctgaatggtgatgaatgccac
atggcgttccacttcccactgatgccgcgcatgtacatggcgctggcccaggaagaccgt
tttcccatcaccgatatcctgcgtcagaccccagagatcccggccaactgccagtgggcg
atcttcctgcgcaaccacgatgagttgaccttggagatggtcaccgacaaggaacgcgac
tacctgtggaattactacgcggccgatcgtcgggcgcggatcaacctggggattcgccga
cgcctggcgccgctgatggagcgcgatcgtcgccgcattgagttgctcaacagcctgctg
ctatccatgcccggcacaccgacgttgtactacggcgatgaaatcggcatgggcgacaac
atctacctgggcgaccgggatggcgtgcgcaccccaatgcagtggtccattgaccgcaac
ggcggcttctcgcgggccgatccggccagcctggtgctgccgccgatcatggacccgcaa
tacggctaccagtcggtcaacgtcgagacccaggccggcgacccgcattcgctgctcaac
tggactcggcggatgctggcggtgcgcaaacagtcccaggccttcggccggggcacgctg
aaaatgctgtccccgagcaaccgtcggatcctggcctatacccgggagtacaccagtccg
gaaggcaagcacgaaatcatcctctgcgtggccaacgtatcccgcagcgcccaggcggcc
gagctggacctgtcgacctacgcgggcatggtcccggtggaaatgctgggcggtaatgcc
ttcccgcccatcggccagttgaatttcctgctgaccttgccgccctatggcttctattgg
ttcgccctggcgacggagaaccaaatgccgagctggcacgtggaaccggcccagagcctg
ccggacttcaccaccctggtgctgaaaaagcgcctggaagaattgctcgaagcgccatcg
cgcaccacgctggagcagaccattctaccgagctggttgcagaaccgtcgttggttcgcc
ggcaaggacagcgccatcgagaaggtcaacattgtctacggcgtgcgcttcggagacccg
cagcatcccgtgttgctcagcgaaatcgacgtcaccagcgctggccagacattgcgctat
caattgccattcggcctgctggccgaagaccaggtgggcgcggcgttgccacagcaattg
gcgctgtcacgcgtacgtcgggtgcgccaggtcggtttgatcaccgacgcgttcagcctg
gaaagcttcatccgggccgtgctccaaggcatccaggccggcacggtgctgccatgcacc
gagggtgagttgcgtttcgaacccaccgaaggcctgaccgcgttgaacctgggagccgag
ccggaagtgcgttatctgtccgccgagcaatccaacagttcagtggtggtgggtggcgct
ttggtgctcaagctgatccgcaaagtcgcctcgggcgtgcatccggaactggaaatgagc
gcctacctgaccgccgcaggtttcagcaatatctcgccgctgctgggttcggtggtccgc
cgtgacgcccagggcgaggatgcgttgctgatgattgcccaaggttacttgagcaaccag
ggtgatgcatgggaatggacccagaacaacctcgaacgcgcgctgcgtgatgaattggcc
gatgccgtgtccgagcaggaacagcattacaacgccttgggcgaactgaaggatttcgcc
ggcatgctcggccagcgcctgggggaaatgcaccaagtgctggcccagcccaccgacgac
ccggccttcgcgccccaggccaccaacgccaaggaagcccaggccatcggcaaggatgtg
gcggcgcaggtggaaaatgccttgcgtctgctcaagcagaaccagggccaactgaaccct
tcggaccaggccatggttgcacgcttgctggagcacaagaaaaccatcctggcccatatc
caggcgctggccggcaaagccgtcggcggcttgcgcatccgcgtccacggcgatctgcat
ttagggcaggtgctggtgatcaagggcgacgcctacctgatcgacttcgaaggcgagccg
gcacggccgctgcatgagcgtcggggcaagcacagcccgtacaaggacgtcagtggcgtg
ttgcgttccttcgattacgcggccgccatggcaatccatttgaacaccgtcgacagcacg
gccgatgccgatgcggcccggcaacgggtggctgatcgttatttggaagaggcccgcgaa
gcatttgttcaggcatatcgactggcggcagctagtcttgctcatgaatggaaggatgct
gaaggcgaagacgccgcgctggcgttgttcggcctggagaaggcggcctatgaagtggcc
tatgaagccgagaatcgccccgcctggctgcccgtgccattgcacggtctgtacgggtta
ttgagtgggcttgaacccttttccgacttagccggaccgatttag

DBGET integrated database retrieval system