KEGG   Pseudomonas brassicacearum DF41: CD58_21840Help
Entry
CD58_21840        CDS       T03174                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pbc  Pseudomonas brassicacearum DF41
Pathway
pbc00020  Citrate cycle (TCA cycle)
pbc00310  Lysine degradation
pbc00380  Tryptophan metabolism
pbc01100  Metabolic pathways
pbc01110  Biosynthesis of secondary metabolites
pbc01120  Microbial metabolism in diverse environments
pbc01130  Biosynthesis of antibiotics
pbc01200  Carbon metabolism
Module
pbc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pbc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CD58_21840
  09105 Amino acid metabolism
   00310 Lysine degradation
    CD58_21840
   00380 Tryptophan metabolism
    CD58_21840
Enzymes [BR:pbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CD58_21840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF4813
Motif
Other DBs
NCBI-ProteinID: AHL35351
UniProt: W8PZW2
LinkDB All DBs
Position
complement(4930772..4931995)
Genome map
AA seq 407 aa AA seqDB search
MAIEIKAPSFPESVADGTVATWHKKPGDAVKRDDLIVDIETDKVVLEVLAEADGVLGAIV
AEEGATVLSNQVLGSIEEGGAAAAAPAAAAAPAAAQAAAPAADGEDDPVAAPAARKIAEE
NGINIASVAGTGKGGRVTKEDVVAAVAAKKAAPAAAPSKPAAPAAAAPVFAAGDRVEKRV
PMTRLRAKVAERLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKSHNGVRLGFMSFF
VKAATEALKRFPAVNASIDGSDIVYHGYADVGVAVSSDRGLVVPVLRNAELMSLAEIEGG
IATFGKKARDGKLSIEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNILQRPMAI
NGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLDI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagccccgtcattcccggaatcggttgccgatggcaccgttgcc
acctggcacaagaaaccaggcgacgctgtaaagcgtgacgacctgatcgtcgacatcgag
accgacaaagtcgttctggaagtgttggccgaagctgacggcgtgctcggcgcaatcgtt
gccgaagagggcgctaccgtcctgtccaaccaggtactgggctcgatcgaagaaggcggc
gctgctgccgctgctccggccgccgctgctgctcctgccgctgcccaggctgctgctcca
gccgccgatggcgaagacgatccagtcgcagccccggccgctcgcaagatcgccgaagag
aacggcatcaacatcgcctccgttgccggcaccggcaagggtggtcgcgtgaccaaggaa
gacgtggtggccgccgttgccgccaagaaggccgcgccagccgctgccccgtccaagcct
gccgcgccagccgctgctgctccggtgttcgctgccggtgatcgcgttgaaaaacgcgtt
ccgatgacccgcctgcgtgccaaggttgccgagcgtctggtcgaagcccagtcgaacatg
gcgatgctgaccactttcaacgaagtcgacatgaccgaagtcatggccctgcgttcgaag
tacaaggatctgttcgagaagtcccacaacggcgtacgcctgggcttcatgtcgttcttc
gtcaaggctgccaccgaagcgctgaaacgcttcccggccgtcaacgcgtcgatcgacggt
tccgacatcgtctaccacggctacgccgacgtaggtgttgcggtctccagcgaccgtggc
ctggtggttccggtcctgcgtaacgccgaactgatgagcctggccgaaatcgaaggcggc
atcgccaccttcggcaagaaggcccgtgacggcaagctgtccatcgaagagatgaccggc
ggtacgttcaccatcaccaacggtggtacattcggttcgatgatgtcgaccccgatcgtc
aacccgccgcaagcggcgatcctgggcatgcacaacatcctgcagcgtccgatggcgatc
aacggtcaagtcgtaatccgtccgatgatgtacctggcgctgtcctacgatcaccgcctg
atcgacggtaaggaagccgtgactttcctggttaccatcaagaacctgcttgaagatccg
gctcgtctgctgctggatatctga

DBGET integrated database retrieval system