KEGG   Pseudomonas brassicacearum DF41: CD58_24455Help
Entry
CD58_24455        CDS       T03174                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pbc  Pseudomonas brassicacearum DF41
Pathway
pbc00473  D-Alanine metabolism
pbc00550  Peptidoglycan biosynthesis
pbc01100  Metabolic pathways
pbc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pbc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CD58_24455
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CD58_24455
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CD58_24455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pbc01011]
    CD58_24455
Enzymes [BR:pbc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CD58_24455
Peptidoglycan biosynthesis and degradation proteins [BR:pbc01011]
 Precursor biosynthesis
  Amino acid ligase
   CD58_24455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 RimK ATP-grasp_5 GARS_A TTL ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AHL35828
UniProt: W8PPH0
LinkDB All DBs
Position
complement(5502279..5503244)
Genome map
AA seq 321 aa AA seqDB search
MTAAYANLVSTLDPKAFGRVAVLFGGKSAEREVSLKSGNAVLQALQSAGVDAFGIDVGDD
FLQRLLNEKIDRAFIILHGRGGEDGSMQGLLECVGIPYTGSGILASALAMDKLRTKQVWH
SLGIPTPRHAVLASESDCISAATELGFPLIVKPAHEGSSIGMAKVNSLPELTAAWKDASS
YDSQVLVEQWITGPEFTIATLRDQVLPPIALGTPHTFYDYDAKYVANDTQYRIPCGLDST
KEKELMDLTAKACEALGIAGWGRADVMQDADGQFWFLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLSILAASVGPQEPRG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgcctacgccaatttggtctcgacccttgacccgaaagccttcggccgcgtt
gccgtgctgttcggcggcaagagcgccgagcgcgaggtgtccctcaagtccggcaatgcc
gtgctgcaagccctgcaaagtgccggtgtcgacgccttcggtatcgacgtgggcgacgat
ttcctgcagcgcctgctgaacgagaagatcgaccgcgcgttcatcattctgcatggccgc
ggcggtgaagacggcagcatgcaaggcttgctcgagtgcgtgggcattccctacaccggc
agcggcatcctggcgtctgccctggcgatggacaaactgcgcaccaagcaggtctggcac
agcctcggcattccgacgccccgtcacgccgtgctggcgtccgagagcgattgtatttcg
gcggccacggaactgggcttccctttgatcgtcaaaccggcccatgaaggttcaagtatc
ggcatggcgaaagtgaattcgctgccagagttgaccgcggcatggaaagacgccagttcc
tacgattcgcaagtgttggtcgagcaatggatcaccggtccagagttcaccatcgccacc
ctgcgtgaccaggtattgcccccgattgcgctgggcacaccgcacacgttctacgactac
gacgccaagtacgtcgccaacgatacccagtaccgcattccttgcgggctggacagcacc
aaggaaaaagaactgatggacctcacggccaaggcctgtgaggcgctgggtattgccggt
tggggacgggcggacgtgatgcaggacgccgatgggcagttctggttcctggaagtcaac
accgctcccggcatgaccgatcacagcctggtaccgatggcggcccgtgccgccggtctg
gatttccagcaactggtgctgtcgatcctggcggccagtgtcggccctcaagagccaaga
ggttaa

DBGET integrated database retrieval system