KEGG   Paenibacillus borealis: PBOR_03180Help
Entry
PBOR_03180        CDS       T03324                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pbd  Paenibacillus borealis
Brite
Enzymes [BR:pbd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PBOR_03180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF2935
Motif
Other DBs
NCBI-ProteinID: AIQ56076
UniProt: A0A089L3L8
LinkDB All DBs
Position
complement(692952..694139)
Genome map
AA seq 395 aa AA seqDB search
MQYVSGAPLPVHILGEIAFWKKQEKEHAGFLIQITPGLEEPYVKLLQEWTVVFIATEQAA
CHLLGSIQTPAFGGPGTLAAETELLLHTACDQSSEFIRQLQAMMKASSAVSASPLAESAV
QHFICESEYFLAVLTALNAPEYGAGMMRQNPVEQAESAAVPAVSISGDPPKEAAALTIPL
WESRDLGSVPIGGHTLPPLPYAYNALEPYIDEKTMMIHHDKHHQSYVDGLNKAENKLAEA
RRNNDYDLVKHWERELAFNGAGHYLHTIFWNVMSPQGGGRPSGALLDAIERSFGSYDAFK
AQFTEAANKVEGGGWAILVWSPRSRRLEILTAEKHQNLSQWDVVPLLALDVWEHAYYLKH
QNNRADYIQDWWKVVNWPYVSERYSAARKLVWQPF
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatgtatccggtgcgccgctgccagtgcacattctaggggaaatcgccttctgg
aaaaaacaggagaaggaacatgccgggtttcttatccagatcactccaggtctggaggag
ccttatgtcaagctgctccaggaatggacggtagtcttcatagctacggaacaggcggcg
tgtcacctgctcggaagtatacagactccggccttcggcggtccgggaacccttgccgcc
gaaacagagctgctgctgcatacggcctgtgatcagtcaagtgaattcatccggcagctg
caggctatgatgaaggccagcagtgccgtgagcgcctcaccactggccgaaagcgcggtg
cagcatttcatctgcgaatcagagtatttccttgccgtgcttacggctctgaatgccccg
gaatacggtgccggaatgatgcggcagaatcctgtagagcaggctgaatccgctgctgtc
cctgccgtctccataagcggagaccctcccaaagaagcggcggccctgacgatccctcta
tgggaatcccgtgatctgggctccgtcccgattggcgggcatacgctgcccccgctcccc
tatgcttataatgcactggagccttacatcgatgagaagacaatgatgatacatcacgac
aaacaccaccagagctatgtagacggactgaataaagcagagaataaattggcggaagcc
cgcaggaacaacgattatgatctggttaagcactgggagcgggagcttgccttcaacggg
gccggtcattatctgcatacgatcttctggaatgtaatgtccccccagggaggcggccgc
ccgtccggagcactgctggatgccatagaacgcagcttcggaagctacgatgccttcaag
gcacagttcactgaagcggccaataaagtggagggcggcggatgggccattctggtctgg
agtccgcgcagccgcagactggagattctgacggccgagaagcatcagaatctgtcccag
tgggatgttgttccgctgctggcactggatgtatgggagcatgcttattaccttaagcat
cagaacaaccgcgcggattatatccaggactggtggaaagtcgtcaattggccttatgta
tccgagcggtacagcgccgcccgtaagctggtctggcagcctttttga

DBGET integrated database retrieval system