KEGG   Paenibacillus borealis: PBOR_15695Help
Entry
PBOR_15695        CDS       T03324                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pbd  Paenibacillus borealis
Brite
KEGG Orthology (KO) [BR:pbd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pbd01001]
    PBOR_15695
Enzymes [BR:pbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PBOR_15695
Protein kinases [BR:pbd01001]
 Serine/threonine kinases: Other
  Bacterial family
   PBOR_15695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like Kdo RIO1 Haspin_kinase FTA2 Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AIQ58213
UniProt: A0A089LGD1
LinkDB All DBs
Position
3612461..3614680
Genome map
AA seq 739 aa AA seqDB search
MIGHELGGRYQVIERIGGGGMALVYRAHDILLNRNVAIKVLRNQFVHDEEFIRRFRREAQ
SAASLSHPNVVSIYDVGQEDEVHYIVMEYIEGKNLNEIIKERAPLQVDESVRIASQICDA
LDHAHMNQIIHRDIKPHNILIGRNGRVKVTDFGIARAVTSTTITQTGSVVGSVHYFSPEH
AKGVTTGEKSDLYSLGIVLYQMLTGVLPFLGESPISVALKHLQEEFEEPRLLNPLIPQSV
ENVILRSMRKNPEERYQSAKQMLQDLETCLLPERRSEAKALFHDDDDEDRTRVIPAIKPL
QRGLGSRGGGDERVRSMEDAPPPPAGKRKSGRAALWISLTLILLIAMGGVVWYVNSKLSV
DEVAVPVVTGISFEEAKAALEEVGLFAEEPPVQAYNPNFAENIVWKQSKTDTMVKEGTHI
ILTVSTAKVLPKLKDVSNMSYDDAVKELIALGIAQNKITPDERYSEDFDKGKVISSEPAA
NSEYDPETVTVKLIVSKGKESTNMPGLLGMTEKEAKAAIEKAGLVLDEVKEEPSFTYEKG
KVTKQWAYEEGDQVTPGEKITIYLSTGYPPEALEYTFPVPVAPAVDGQRSKIRIVFADAR
NNGENQEWGTRTIGKSQTLSVNMVLAPNKDGMVSVYRDGEFLETYPITYVDVKNNNVQTP
EPPPVQTQTPEPTVAPTEPPAEPTIEPEILPPGAGEGEETGQGDQTGFIPGKENNNKLLA
ASQGNNNGNGKGKGKSKNK
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcacgaattgggcggccgttaccaagtcatcgaacggatcggcggaggtggc
atggcgctcgtctacagagcccatgacattctgcttaaccggaatgttgctatcaaagta
ttgcgcaaccagtttgtgcatgatgaggaattcatccgccggttccggcgggaggcgcaa
tcagctgcatcgttatctcatccaaatgtagtcagcatttacgatgtcggccaggaagat
gaagtccattatattgttatggaatatattgaaggcaagaatttgaacgaaattattaaa
gagcgggctccgctgcaggtcgatgagtctgtgcggattgcttcacaaatttgtgatgcg
cttgatcatgcgcatatgaaccagatcattcaccgcgatattaaacctcataatattctg
atcggccgtaatggccgggtcaaagtaacggatttcgggattgcccgggcggttacatcc
actacgataacccagacgggttctgtggtcggttctgtccactatttctcgccggagcat
gccaaaggtgtgacgacgggagagaagtctgacctgtattctctggggatcgtgctctat
cagatgcttaccggagtgctgccttttctgggcgaaagcccgattagtgtagcgctgaag
catctgcaggaggaattcgaggagccgcgtctgctgaatccgctgattccgcaaagcgta
gagaatgtaattctgagatcgatgcgcaagaacccggaggaacggtaccagtccgccaag
caaatgctgcaggatctggagacctgtctgctgcctgaacggcggagtgaagccaaagcg
ctgttccacgacgacgatgatgaggacagaacgcgggtgattccggcgatcaagccgctc
cagcggggtctgggcagccgtggcggcggagatgaacgtgtccgcagtatggaggatgct
ccgcctcctccagccggcaagcgcaaatcgggccgtgcagcactatggattagtcttacc
cttatactgctgatcgctatgggcggggtcgtctggtatgtcaactccaaattgtccgtg
gatgaagtggcggtgccggtagttaccggtatttcttttgaggaagccaaagctgcgctt
gaagaggtgggcttgttcgcagaggagccgccggtgcaggcatacaatccgaattttgca
gaaaatatcgtctggaaacagagcaagactgacacgatggtcaaggaaggcacgcatatt
atccttacagtaagtaccgccaaggtactgcctaagctaaaggatgtttctaatatgagc
tatgatgatgccgtcaaagagttaattgcgctaggtatagcccagaataaaatcactccg
gacgaacgttacagtgaggattttgacaaaggcaaagtaatcagctctgagcctgcggca
aatagtgagtatgatcctgagacagtaacggttaagctgatcgtgagtaaggggaaagag
agcacgaatatgccgggcctcctcggaatgacagagaaggaagccaaagcagcgattgag
aaagccggccttgtgctggatgaggttaaggaagagcccagcttcacttatgagaagggc
aaagtcacgaagcaatgggcatatgaggaaggggatcaggttactcccggagagaaaata
accatttacctcagtaccggttatcctccggaagcactggaatataccttcccggttcca
gttgcaccggccgtggacggccaaagaagcaaaatccggattgtctttgcagatgcgcgt
aataatggcgagaaccaggagtggggcacacgcacgattggcaaaagtcagaccttatct
gtgaacatggtgcttgctcccaacaaggacgggatggtttccgtataccgggacggggaa
ttcctcgagacctatcctataacttatgtggatgtcaagaataacaatgtacagacccct
gagcctcctccggttcagactcagactcctgagccgaccgttgcacctactgaacctccg
gctgagcctacgatagaacctgagattctgccgccgggtgccggagaaggcgaagagaca
ggtcagggagatcagaccggcttcattccgggcaaagaaaataataataaactgcttgcc
gcttctcaaggaaataataatggaaatggcaagggcaagggcaaaagcaaaaataaataa

DBGET integrated database retrieval system