KEGG   Paenibacillus borealis: PBOR_20205Help
Entry
PBOR_20205        CDS       T03324                                 

Definition
(GenBank) dienelactone hydrolase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pbd  Paenibacillus borealis
Pathway
pbd00010  Glycolysis / Gluconeogenesis
pbd00020  Citrate cycle (TCA cycle)
pbd00620  Pyruvate metabolism
pbd01100  Metabolic pathways
pbd01110  Biosynthesis of secondary metabolites
pbd01120  Microbial metabolism in diverse environments
pbd01130  Biosynthesis of antibiotics
pbd01200  Carbon metabolism
Module
pbd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pbd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PBOR_20205
   00020 Citrate cycle (TCA cycle)
    PBOR_20205
   00620 Pyruvate metabolism
    PBOR_20205
Enzymes [BR:pbd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PBOR_20205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 NQRA RnfC_N ATP-synt_ab_Xtn HlyD_3
Motif
Other DBs
NCBI-ProteinID: AIQ58992
UniProt: A0A089LDS2
LinkDB All DBs
Position
complement(4652575..4654221)
Genome map
AA seq 548 aa AA seqDB search
MAKFEYRFPELGEGLHEGEIIKMHIKAGDKVTDDDIVMEVQNDKAVVEVPCPVNGTVLEV
FTKDGQVCRVGEVVAIIDAEGDVPEQEGGHPAEQASQEADAAKGGADTTSSPATSSPATG
GATNFEYKFPELGEGLHEGEIIKMHIKVGDKITDDDIIMEVQNDKAVVEVPSPVNGTVVE
VFTKDGQVCRVGEVVAIIAAEGDVPQQEGGHAEASGAQAAAPAQAPAAVAAAAPAPNREV
LATPSVRKFARDKSVDITQVNGSGKNGKITLEDVEAFLKGGSAASAPAASAPAAAAATAA
PKAAAAAPAASGNANLEEERVPFKGIRKAIANAMVKSAYTAPHVTIMDEVDVTELVAFRA
RMKPVAEKKGVKVTYLPFIVKALVAASRQFPALNAMIDEATNEIVYKKYYNIGIATDTDN
GLIVPVIKDADRKSIWMIASSITDLAVRGRDGKLAPNEMKGSTISISNIGSAGGMFFTPI
INFPEVAILGTGRITEKPVVKNGEIVAAPVMALSLSFDHRIIDGATAQNFMNYIKTLLAN
PDMLVMEV
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaatttgagtaccggttccctgagctgggcgaaggtctgcatgaaggtgaaatt
atcaaaatgcatatcaaagccggcgacaaagtaaccgatgacgatatcgtaatggaagtt
cagaacgacaaggcagtagttgaggttccttgtccggtcaacggcacagtgcttgaagtc
ttcaccaaagacggccaagtatgccgtgtaggcgaagtagtggcaattatcgatgcggaa
ggcgacgttcctgaacaggaaggcggccatcctgcagaacaggcttcccaggaagcggat
gcagctaagggcggagcagatacaacatcatctcctgcaaccagcagcccggctactggc
ggagctaccaactttgaatacaaattccctgaactgggcgaaggcctgcatgaaggtgaa
attatcaagatgcacatcaaggtcggcgacaaaattaccgacgatgatatcatcatggaa
gttcagaatgataaggctgtagttgaagttccttctcctgtcaacggtacagtggtagaa
gtgttcaccaaagacggtcaagtatgccgtgtaggcgaagtggtggcaatcattgctgca
gaaggcgatgttcctcagcaagaaggcggtcatgctgaagcttctggtgcacaggcagca
gctccggctcaagctccggcagcagtagcggcagcagctccggcccctaaccgtgaagta
ctggctacacctagcgtgcgcaaatttgcccgtgacaagagtgtggacatcactcaggtg
aatggcagcggcaagaacggcaagatcacacttgaagatgttgaagccttcctgaagggc
ggatctgcagcatcggctccagcggcatctgcaccggcagcagctgcggctacagcagca
cctaaggctgcagcagcggcaccggcagcttccggcaatgcaaacctggaagaagaacgt
gtaccattcaaaggtatccgtaaagcgattgctaacgcgatggttaaatcggcatacaca
gcgccgcatgttaccattatggacgaagtggatgttactgagcttgttgccttccgcgcc
cgtatgaaacctgtagctgagaagaaaggcgtgaaggtaacttaccttccgttcatcgtg
aaggcactcgttgctgcttcccgtcaattccctgcgcttaacgccatgattgatgaagct
acaaacgaaattgtctacaagaaatactacaacatcggtattgctacagatacagataac
ggtctgatcgttcctgtaattaaggatgctgaccgcaagagcatctggatgatcgctagc
agtattacagatctggcagtccgcggacgcgacggcaaactggctccgaatgaaatgaaa
ggcagcaccatctcgatcagtaacatcggttccgcaggcggtatgttcttcacaccaatc
atcaacttccctgaagttgcgattctgggtacaggacgcatcactgagaagccggttgtg
aagaatggcgaaatcgttgctgctccggttatggccctgtcactaagctttgaccaccgt
attattgatggtgcaacagcacagaacttcatgaattacattaagaccttgcttgcaaat
cctgatatgttagttatggaggtgtaa

DBGET integrated database retrieval system