KEGG   Paenibacillus borealis: PBOR_28145Help
Entry
PBOR_28145        CDS       T03324                                 

Definition
(GenBank) (p)ppGpp synthetase
  KO
K00951  GTP pyrophosphokinase [EC:2.7.6.5]
Organism
pbd  Paenibacillus borealis
Pathway
pbd00230  Purine metabolism
pbd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PBOR_28145
Enzymes [BR:pbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     PBOR_28145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD_4 RelA_SpoT TGS ACT_4 ACT HD ThiS ACT_6 DUF493 Ub-Mut7C
Motif
Other DBs
NCBI-ProteinID: AIQ60390
UniProt: A0A089LJZ6
LinkDB All DBs
Position
complement(6383617..6385797)
Genome map
AA seq 726 aa AA seqDB search
MGIEQLTEKAGAYIKEKDLLRIREAYEFADQAHHGQVRKSGEPYILHPLAVADIVVNMQM
DVISIIAALLHDVVEDTTVSLDQIRAKFGDTCAMLVDGLTKLERIRFRSKEEQQNENYRK
MFIAMAQDIRVIVIKLADRLHNMRTLKYQSEESQRRISYETLEIFCPIADRLGISAIKWE
MEDIALRYLNPQQYYRIANLVHKKRAEREQFIDSVIGRIRAKLDEMGIEGDLSGRPKHIY
SVYNKMSTKNKQFNEIYDLLAIRIIVDNIKDCYATLGIIHTLWKPMPGRFKDYIAMPKAN
MYQSLHTTVVGPGGEPTEVQIRTWEMHRTAEFGIAAHWAYKEGSSNNVNPENRMPFFREI
LELQHEAKDAEEFVESLKMDFFSDLVFVFTPKGEVVELPAGSVPLDFAFRIHTEVGNRTI
GSKVNGRIVPLDHKLKTGDIVEILTSKNSYGPSRDWLKIAQSSHARSKIKQWFKKEKREE
NVEKGREAIERELKRLNVEVSDWLTEDKLSEAAKKFAFNDVEDMLSAVGFGGITAAQIAS
KLTEKLRKDQEEAAGHLELTSEMKEIKSSGEKRNQPTNGVRVKGIDNLLVRFARCCNPVP
GDDIIGYVTRGRGVSVHREDCPNIPGEGDGEESARVIEVEWEGSMEANYSVDIEITGHDR
NGLLNEVLQAVSESKTNISAVTGRSDKNKMAMIHMTILIRNTDHLQSVVDKVKRVKDVYT
VNRIMQ
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgggcatagagcaattaaccgaaaaggccggcgcctatataaaagaaaaagatcttctc
cgcatccgggaagcttatgagtttgccgatcaggctcatcacgggcaggttcggaaatcg
ggggagccatacattctgcatccgctggcggtcgcagatattgtcgtcaacatgcaaatg
gatgttatatctattattgcagcgctgttgcatgatgttgtagaagatacgacggtgtca
ctggaccagattcgcgcgaaatttggcgatacctgcgccatgctggtggacggtctgacc
aagctggaacgcatccggttccgctctaaggaagagcagcagaacgagaattaccgcaaa
atgttcatcgctatggctcaggatatccgggtcattgtgattaagctggcggaccgtctg
cataatatgcgtacgctcaagtaccagtcggaagagagccagcgccgtatttcctatgag
actctggagattttttgtcccattgcggaccgcttggggatctctgcgattaaatgggag
atggaggatattgccctccgttatctgaatccgcagcagtattaccggattgccaatctt
gtacacaagaaacgggcagaacgtgagcagtttatcgacagcgttatcgggcggatccgc
gccaagctggatgaaatgggcatcgaaggggatctttcgggacgcccgaagcatatttac
agtgtctataacaagatgagcaccaagaacaagcagttcaacgaaatctatgatctgctg
gccatccgcattatcgtcgacaatattaaggattgttatgctacgttaggaattatccat
actctttggaagccgatgcctggccggttcaaggattatatcgccatgcccaaagcgaat
atgtatcagtctttgcatacaacggtagtgggtcccggaggggagcctactgaagtgcag
atccgtacctgggagatgcaccgtacggccgaattcgggatagctgcgcattgggcgtat
aaggaaggcagcagcaacaacgtgaatccggagaaccggatgccgttcttccgcgagatt
ctggagctgcagcatgaagctaaggatgcggaagaattcgtggagtcgctcaaaatggac
tttttctccgacctcgtctttgtgttcacgcctaagggtgaggttgtagagctgcctgca
ggctctgtgccgcttgacttcgcgttccgcatccatacagaggtcggcaaccggacgatc
ggctccaaggtcaacgggcgcatcgtaccgctcgaccataagctgaagaccggggatatc
gtggagattctgacctcgaagaactcgtacgggccgagccgtgactggctgaagattgcc
cagtcttcacatgcgcgaagcaagatcaagcaatggttcaagaaggagaagcgggaagag
aacgttgaaaaaggccgtgaagcgatcgaacgtgagctgaagcgcctgaacgtggaggtc
tctgactggctgacggaagataaattgtcagaagcagcgaagaaattcgccttcaatgat
gtagaggatatgctctccgcagtaggttttggcgggattacagccgcgcagattgcctcc
aagctgaccgagaagctgcgtaaggaccaggaagaagccgccggtcatctggagctgact
tctgagatgaaggagatcaaatccagcggggagaagcgcaatcagccgaccaacggcgtg
cgtgtcaaagggattgataatctgcttgtacgcttcgcacgatgttgtaatcccgtgccg
ggcgacgatattattggttatgtaacccgcggacgcggcgtatccgtgcaccgtgaggat
tgtccgaacattccgggtgaaggggacggggaggaatcagcccgtgtcattgaagtggaa
tgggaaggcagcatggaggccaactatagcgtcgatattgagattacgggccatgaccgc
aacggactgctgaatgaagtgctgcaggcggtgtcggagagcaagaccaatatctcagcg
gttacgggacgctctgacaagaacaagatggcgatgattcatatgacgattctgatccgc
aacaccgatcatctgcagtctgtggtggataaggtcaagcgcgtgaaggatgtttatacg
gttaaccgcattatgcaataa

DBGET integrated database retrieval system