KEGG   Paenibacillus borealis: PBOR_32285Help
Entry
PBOR_32285        CDS       T03324                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pbd  Paenibacillus borealis
Pathway
pbd00620  Pyruvate metabolism
pbd00680  Methane metabolism
pbd01100  Metabolic pathways
pbd01120  Microbial metabolism in diverse environments
pbd01200  Carbon metabolism
Module
pbd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pbd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PBOR_32285
  09102 Energy metabolism
   00680 Methane metabolism
    PBOR_32285
Enzymes [BR:pbd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PBOR_32285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 OTCace Enkurin
Motif
Other DBs
NCBI-ProteinID: AIQ61069
UniProt: A0A089MXE0
LinkDB All DBs
Position
complement(7331368..7334160)
Genome map
AA seq 930 aa AA seqDB search
MTELTTTVSKSNSNNLLRRDVRFLGNILGEVLVHQGGNELLDIVEKIRETSKSLRSLFLP
ELHNEFKELISSLDPENRHQVIRAFAIYFQLVNIAEQNHRIRRKRDYERSAGETVQPGSI
ESAIQELRERDFSHEDVHEIMNGLSLELVMTAHPTEAMRRAILDIHKRISDDVMGLDNPT
LTFREREQLREKLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETIFEVLPDVYQELE
RCLSKYYPGQNWHVPTYLRFGSWIGGDRDGNPSVTAAVTLQTLRLQRKLAIREYQRIMRE
LMQYLSFSTSIVNVTPELLESIEQDRNIINLNRVDAWRNDNEPYRIKLSYMISKTQNVLD
DEKKGTPVRYASPEQFIDDLNVIDRSLRHHYADYVADTYIKKLIRQVELFGFHTSTLDVR
QHSQEHENAMTEILAKMNVTPDYSKLEEKEKIELLEKLLNDPRPLTSPYQSYSEGTEECL
AVYRTIFQAQEEYGKQCITSYLISMAEAASDILEVMVFSKEVGLFRKDNDGTVVCTLQAV
PLFETIDDLHDAPQIMRTLLSMPIYRDGVRAMNDLQEIMLGYSDSNKDGGVVTANWELRV
ALKQITATADEFGIRLKFFHGRGGALGRGGMPLNRSILAQPASTIGGGIKITEQGEVISS
RYSMKGIAYRSLEQATSALVTAAIHARSPQADLYEAKWDEIIARISEVSLNKYQDLIFRD
PDFLTYFKESTPLPEVGELNIGSRPSKRKNSERFEDLRAIPWVFAWTQSRYLLPAWYAAG
TGLQSFYEDKEENLKIMQHMYANFSFFTTLIDTLQMAIAKADLVIAKEYASMGKNEEARV
RIFGQIEAEFKLTSELILKITGQQDILDNVPVIQESIRLRNPYVDPLSYLQVQLLAELRA
LRDAEGDDAELLREVLLTINGIAAGLRNTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacttacgactaccgttagcaaaagcaactccaacaatctgctgcggcgggac
gtacggttcctggggaatattctgggcgaagtcttggtacaccaaggcggcaacgaactg
ctggatatcgtggagaagatccgtgaaaccagtaaatcgctgcgctcattgtttttgcct
gaactgcacaatgaatttaaagagctgattagttcactggatccggagaaccgccatcag
gtgatacgggccttcgccatttattttcaactggtgaatatagccgagcagaatcaccgc
attcgccgtaagcgcgattatgaacgttctgccggggagacggtacagccgggatcgatc
gaaagtgcgattcaggagctccgcgagcgggatttctctcacgaggatgttcatgagatc
atgaacggcctgtctctggaactagttatgaccgcccatcctacggaagccatgcgccgt
gcgatcctcgatattcacaaacggatctccgacgatgtcatggggctggataatccgact
ctgactttccgcgaacgtgaacagctccgtgagaagctgctgaatgaagtaattaccctg
tggcagacggatgagttacgtgaccgcaaacctactgtgcttgatgaagtgcgcaatggt
atgtactatttccatgagacgatttttgaagtgctgccggatgtataccaagaacttgag
cgatgtctaagcaaatattacccgggccagaactggcatgtgccaacctatctgcgtttc
ggttcttggattggcggagaccgtgacggtaacccttcggtgactgcggccgtaactttg
cagacgctgcgtctgcagcgcaagctggctattcgtgaatatcagcggattatgcgcgaa
ttgatgcaatacctgagctttagtacaagcatcgtcaatgtgacgccggagctgctggag
tccattgagcaggaccgtaacattatcaatcttaaccgggtcgatgcctggcgcaatgat
aatgaaccttaccggattaagctcagctatatgatctctaagacacagaatgttctggac
gatgagaaaaaaggcacgcctgtgcgctacgcttcaccagagcaatttatagatgatttg
aatgtgattgaccgcagcttgcggcatcactatgccgactatgtagcagacacctacatt
aagaagctgatccgccaagtggagctgttcggcttccatacgtccacactggacgtccgc
cagcacagccaggagcatgagaatgcaatgacggagattctggccaagatgaatgttacg
ccggactactccaagcttgaggagaaagagaagattgagctgctcgagaagctgctgaat
gatccgcgcccgctgacatccccataccagtcttatagtgaaggtacggaggaatgcctt
gcggtataccggacgatcttccaggcacaagaggagtacggcaagcagtgtatcaccagc
tatctgatcagtatggcggaagcggcaagtgatattcttgaggtgatggttttctccaaa
gaagtaggcttgttccgcaaagataacgacggtacagttgtttgtactttgcaggcggtg
ccgctgtttgaaacgatcgacgaccttcacgatgcgccgcagattatgcgtacactgctc
agcatgccgatctaccgtgacggggttagagcaatgaatgatctgcaggagatcatgctg
ggttattcggacagcaataaagacggcggtgtggttactgcgaactgggagctgcgtgtt
gccctgaagcagattacagcgactgccgatgaattcggcattaggctgaagttcttccac
ggacgcggcggagcactcggacgcggcggtatgccgctgaaccggagtattctggcccag
ccggcttccactattggcggcggcatcaagattaccgagcagggtgaggtgatctcttcc
cggtattcgatgaaggggattgcttaccgcagtctggagcaggcgacatccgctttggtt
acggcagcgattcacgccagatcgccacaggcggatctgtatgaagccaagtgggatgag
attattgcccgcatctctgaagtctccctgaacaaatatcaggatctgatcttccgtgat
ccggatttcctgacgtacttcaaagaatcaaccccgctgccggaggtaggggaactgaat
atcggttcacgtccttcgaagcgcaagaacagtgaacgcttcgaggatctgcgtgccatc
ccttgggtattcgcctggacgcagagccgttatttgctgcctgcatggtatgcggccgga
acaggactgcagagcttctatgaggataaagaagaaaatctgaagatcatgcagcatatg
tatgccaacttctctttcttcactactttgatcgataccctgcagatggctattgccaag
gcggatcttgtaatcgccaaggaatacgccagtatgggcaaaaatgaggaggcacgtgtg
cggatcttcggccagattgaagccgagttcaagctgacctccgagctgatcctgaagatc
actggccagcaggacattctggataatgttccagttattcaggagtcgatccgcctgcgc
aacccgtatgttgacccgctcagctacctgcaggttcagctccttgctgagcttcgtgcc
ctgcgtgatgccgagggcgatgacgccgagctgctgcgtgaggtgctgcttacgatcaac
ggtatagccgccggtctccggaataccggctga

DBGET integrated database retrieval system