KEGG   Paenibacillus borealis: PBOR_33550Help
Entry
PBOR_33550        CDS       T03324                                 

Definition
(GenBank) flagellin
  KO
K02406  flagellin
Organism
pbd  Paenibacillus borealis
Pathway
pbd02020  Two-component system
pbd02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:pbd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PBOR_33550
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    PBOR_33550
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:pbd02035]
    PBOR_33550
Bacterial motility proteins [BR:pbd02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    PBOR_33550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flagellin_N Flagellin_C
Motif
Other DBs
NCBI-ProteinID: AIQ61278
UniProt: A0A089LPZ4
LinkDB All DBs
Position
complement(7577230..7578915)
Genome map
AA seq 561 aa AA seqDB search
MIINHNIPALNTHRQLSINTANTNKNIEKLSSGLRINRAGDDAAGLAISEKMRGQIRGLD
QASRNAQDGISLIQTAEGALNETHSILQRQREIANQSANGTNTDADRQALQDEMNQLTSE
INRIGNTTEFNTQKLLNGGIGSGESGKLTQATSAKVTATTAISSGAITLTAGATITVDNQ
TFDLSAIKVGSVGASVANNASALKTALESVTSGGVKLSDLVDIKVGTGNKLEITAKSTGT
SSELKFTGASSSLGLSAAQIGVTLKGDPSTIERAGVEAATSLTAGATIASQSTIKFTIGS
ESEVEVTLNSGTADKVYKTNDPDANVAKAAMADLVKDLNAALQTAGLESKVTASLSKDNK
IQFISETGKDITVAAGTGGALAALGGGLNAVKNVDQVVGAGAQGVGFSTKFQIGANTGQS
MSLQINDVRAAALGITGNAGQAGFTKENAVTNGSNDVKSEAALNIATREDASKAIAVLDK
ATSLVSSERAKLGAVQNRLEHTINNLGTASENLTAAESRVRDVDMAKEMMQQTKNNILAQ
AAQAMLAQANQQPQGVLQLLR
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgattatcaaccacaatattccggcgttgaacactcaccgccaactgtctatcaacaca
gctaacactaacaaaaatattgagaaattgtcttccggtcttcgcatcaaccgtgctggt
gatgacgccgctggtctggcaatctccgaaaaaatgcgcggccaaatccgcggtttggat
caggcttcccgtaatgctcaagacggtatctctttgattcaaactgctgaaggtgcactg
aacgaaactcactccatcctgcaacgccaacgcgaaattgcgaaccaatcagcaaacgga
acgaacactgatgctgaccgtcaagcgctgcaagatgagatgaaccagctgacttctgaa
atcaaccgtatcggtaacacaactgagttcaatactcagaaactattgaacggtggtatt
ggttcaggtgaaagcggcaagctgactcaggcaaccagtgctaaagtcactgcaactaca
gcaatttcttcgggagcaatcactcttactgccggagcaactattactgtagacaatcaa
acgtttgatctttcagcaattaaggtaggttctgtaggtgcttctgtagcaaataatgca
agtgccctgaagacagcactagagtctgttacttcgggtggtgttaaattatctgacctg
gtagatatcaaagtcggaacgggtaataaactggagattacagctaaatctacaggtact
tcaagtgaactgaagtttacaggagcgagctctagtctgggcttgagtgcagcgcaaatt
ggtgtaactcttaagggagatccatcgactatagaacgtgctggggttgaggctgctact
tcgcttacagcaggtgctactattgcttcacagtcaaccatcaagtttactattggttct
gaaagcgaagtggaagttactcttaactctggtactgcagacaaggtttataaaacaaat
gatcctgatgccaatgttgctaaagcagctatggctgatctcgttaaagatttgaatgca
gcactgcaaactgccggactggaaagcaaagtaacagcatctttgtccaaggacaacaag
attcagtttatttctgaaactggtaaagatattacagtagctgctggtaccggtggggcc
ttagctgcacttggcggcggtttgaatgctgttaagaacgttgaccaggttgtaggtgct
ggagctcaaggtgtaggatttagcacgaaattccagattggtgctaacacaggtcaatct
atgtccctgcaaatcaacgatgttcgcgcagcagcacttggtatcacaggaaatgctgga
caagctggtttcactaaagagaatgccgttactaacggttccaacgatgttaaatctgaa
gctgcgttgaatatcgctacccgtgaagatgcttccaaagcaattgctgttctggataaa
gctacttccctggtatcgagcgaacgcgctaaactgggtgctgtgcagaaccgtctggag
cacacaatcaacaacttgggaacagcttccgagaacctgacggctgctgaatcccgtgtc
cgtgacgttgacatggccaaagaaatgatgcaacaaactaagaacaacatccttgcgcaa
gctgcacaagcaatgttggctcaagctaaccaacagccgcaaggcgtactgcaactgctg
agataa

DBGET integrated database retrieval system