KEGG   Plasmodium berghei: PBANKA_051820Help
Entry
PBANKA_051820     CDS       T01111                                 

Definition
(RefSeq) flavoprotein subunit of succinate dehydrogenase, putative
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pbe  Plasmodium berghei
Pathway
pbe00020  Citrate cycle (TCA cycle)
pbe00190  Oxidative phosphorylation
pbe01100  Metabolic pathways
pbe01110  Biosynthesis of secondary metabolites
pbe01130  Biosynthesis of antibiotics
pbe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PBANKA_051820
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PBANKA_051820
Enzymes [BR:pbe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PBANKA_051820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 DAO GIDA Lycopene_cycl HI0933_like FAD_binding_3 NAD_binding_8 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 3422000
NCBI-ProteinID: XP_673585
UniProt: A0A077X9Q7
LinkDB All DBs
Position
5
AA seq 631 aa AA seqDB search
MISRGVRKFNFIRSSYFHFSFIKNKAYDIIDHHYDAVIVGAGGAGLRSALELSKNKYKVA
CISKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTIKGSDWLGDQNAIHYMCREAPE
SVIELEEFGLPFSRTKDGKIYQRAFGGQSLKYGKGGQAYRCAAAADRTGHAMLHTLYGQS
LSHNCIFFVEYFVLDLLMLNPEECIGVICINIADGKIHRFFSPHTVIATGGYGRAYLSCT
SAHACTGDGNAIVARSKLPLQDLEFVQFHPTGIYPAGCLITEGCRGEGGILRNREGEAFM
MRYAPKAKDLASRDVVSRAMTIEINENRGCGPNADHIYLDLTHLPHETIKERLPGIMETA
KIFAGVDVTKQYIPVLPTVHYNMGGIPTNYKTQVLTQSKNFDKLTNNSTDDIIVKGLYAA
GEAASASVHGANRLGANSLLDIVVFGKRAALTIMEIDKPNIPKIKPNTNIGEETIQRLDQ
IRFNKGTIQTANVRKNMQVCMQKHAAVFRVGPLLDKGYKGILNICSQFKDVYINDKTLTW
NTDLLETLELENLLTLSAQTILAAINRKESRGAHARDDFPERDDQNYLKHSLTWMTNRDV
EKSDFFTTYRSVITKPLDNEMEYVPPVKRVY
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgatctcaagaggggtacgaaaattcaattttattcgctccagttactttcatttttcc
ttcattaaaaataaagcatatgatattatagatcaccattatgatgctgtgattgtagga
gcaggtggcgcaggtttgagatcggctttagaactatcaaaaaataaatataaagtggca
tgcattagtaaattatttccaactcgatcacatacagtagcagcacaaggaggtataaat
gctgccttagggaatatgactgaggatgattggaggtggcatgcttatgatactattaaa
ggatcggattggctaggtgatcagaatgctattcactatatgtgtagagaagcccccgaa
tctgttattgaattagaagaatttggtttacccttttctagaacaaaagatggtaaaata
tatcaaagggcatttggtggccaaagtttaaaatacggtaaaggagggcaagcatataga
tgcgcagctgctgcagaccgaacagggcacgctatgttacatacattgtatgggcaatcg
ttgtcacataattgtatattttttgttgagtattttgtattagatttattaatgttaaat
cctgaggaatgcattggggttatatgtattaatattgcagatggaaaaatccatcgattc
ttttcaccacatacagttattgcaacaggtggatatggtagagcatatttatcttgtact
tctgcgcatgcatgtacaggtgatggtaatgctatagttgctagaagtaaattgccttta
caagacttagaatttgttcaatttcatccaactggtatatatcctgctgggtgtttaatt
acagagggttgtagaggagaaggggggattttgagaaatagagaaggggaagcatttatg
atgcgatatgcaccaaaagctaaagatttagctagtcgagatgtagtgagtagagctatg
acaatagaaataaatgaaaaccgaggatgtggccccaatgcagatcatatttatctagat
ctgacacatttaccacatgaaacgataaaagaaagattacctggtattatggaaacagct
aaaatttttgcaggcgtagatgtaacaaagcaatatataccagttttacctacagttcat
tataatatgggggggataccaactaattataaaacccaagtattaacacaatctaaaaat
tttgataagctcacaaataattcgacagatgatataatagttaaaggactttatgctgca
ggcgaagctgcatctgcatctgtacatggagctaatcgattaggtgccaattcgttatta
gatattgttgtatttggaaaaagagcagccttaactattatggaaattgataaaccaaat
attcccaaaattaaacctaatacaaatataggtgaagaaacaatacaaagattagatcaa
ataagatttaataagggtacaattcaaacagctaatgttagaaaaaatatgcaagtatgt
atgcaaaaacatgcagcagtttttcgcgtaggccctttattagataaagggtataaagga
atacttaatatttgttcacaatttaaagacgtttatattaatgataaaactttaacatgg
aatacagatttattagaaacattagagctggaaaatttattaacattatcagcccaaact
atattagctgctattaatcggaaagaatcacgaggggcacatgctcgtgatgatttccct
gagagagatgatcaaaactatttgaaacattccttaacatggatgacaaatagggatgta
gaaaaatcggatttttttacgacatacagaagtgtaattacaaaacctttagacaatgaa
atggagtacgtacctccagttaaacgtgtttattaa

DBGET integrated database retrieval system