KEGG   Plasmodium berghei: PBANKA_133390Help
Entry
PBANKA_133390     CDS       T01111                                 

Definition
(RefSeq) conserved Plasmodium protein, unknown function
Organism
pbe  Plasmodium berghei
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 3423087
NCBI-ProteinID: XP_674638
UniProt: A0A077XGB8
LinkDB All DBs
Position
13
AA seq 577 aa AA seqDB search
MDKNLRMIARNIFVNGEMLWGRPKKCIEFLFNKKYITTNISENKEKKTKNIEHIKLKNFK
KNKNIIKNNNNNEDAYVLNGKILYAPKNKKKQINELQIKYPAKKIKNIDNNASNVYYNKL
GNNNIKKNNLIIQIDQTDGKLKRQIENGDNYTSKKERISIKLNGDDDTNFKTTSFNSNNN
INLNLDTAIYNNYHHTSFSDINANYAQNKKSAHINFLSKHDNTQNVESEFTQFANTNKNC
IYNEVPLFNTLKAKEVSDNSIVNTICNSSTNLGMITQNSFNLNSNANSNSSQEKNNKNDT
IDTSLNNNNRDNKNNEEIKQDIYEVLNEINCSSNKKEIEDFLNNFFLYKSKKPSSILGNY
ISFYFCNILSEDLRNLKHSCFDGVKLCVNTFLGTIKELDEKQLSKMANIYLEDYFLKIFK
ILKEHNLSLHFDNISIDNIKLLYIYNILGITRKDGKRIKKENIKKFLYQYICVDNKDIAL
LKNTTRMKFLSNIIKNGVTTRMHVLVNLSYDVSAYNALTENCFIKTNFKNINLELVFENQ
LENPFFSLQSPDSIDLKSSGWYLVDVNQILNGNLPYE
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaatctcagaatgattgctcgaaatatatttgtgaatggggaaatgctttgg
ggtaggccaaaaaaatgcatagaatttctttttaataagaaatatatcactacgaatata
tctgaaaacaaagaaaaaaaaactaaaaatatagaacatataaagctaaaaaattttaaa
aagaataaaaatattataaaaaataataataataatgaggatgcatatgttctaaatggc
aaaatattatatgccccaaaaaataaaaaaaaacaaataaatgaattacaaataaaatac
cctgcaaaaaaaataaaaaatatagacaataatgcaagcaatgtatattataacaaatta
ggtaataataacataaaaaaaaataacttaataattcaaatagatcaaacagatgggaaa
ttaaaaagacaaatagaaaatggtgataattatacaagcaaaaaagaacgaatatcaata
aaattaaacggagatgacgatactaattttaagactacctccttcaatagtaataataat
atcaacttaaatttggacactgcaatatacaataattatcatcatacaagtttttctgat
attaacgcgaattatgcacaaaataaaaaatcagctcatataaattttttaagtaaacat
gataatacacaaaatgttgaaagtgaatttacacaatttgctaatactaacaaaaattgt
atatataatgaagttcctttattcaataccttaaaggccaaagaagttagtgacaatagt
attgtaaacaccatatgtaatagctctacaaatctgggaatgataactcaaaatagcttt
aatttaaattctaatgctaattcaaattcttcacaagaaaaaaataataaaaatgacaca
attgataccagcctaaataataataatcgagacaataaaaacaatgaggaaataaaacaa
gacatttacgaggttctaaacgagataaattgcagctcgaataaaaaagaaatagaagat
tttttaaacaatttttttttatataaaagcaaaaaaccatctagcatactaggaaattat
ataagcttttatttttgcaatatattaagtgaagatttacgaaatttaaaacattcatgt
tttgatggagtaaaattatgtgttaatacctttttaggtacaataaaagaattagatgaa
aaacaactatctaaaatggcaaatatatatttagaagactattttttaaaaatatttaaa
attttaaaagaacataatttaagtttacattttgacaatatatcaatcgataatataaag
ttgttatatatatataatatattaggcataactcgaaaagatggaaaaagaataaaaaaa
gaaaacattaaaaaatttttatatcagtatatatgtgtagataataaagatattgccctg
ttaaaaaatactactcgaatgaaattcttatcaaatataattaaaaatggtgttacgaca
cgtatgcatgtgttagttaatctttcatatgatgtatcggcgtataatgcgcttacagaa
aattgttttattaaaacaaattttaaaaatattaatttagagttagtatttgagaatcag
cttgagaacccatttttttctttacaatctccagattctatagatttaaaatcctctgga
tggtatttggttgatgttaatcaaatattgaatggtaatcttccatacgaatga

DBGET integrated database retrieval system