KEGG   Plasmodium berghei: PBANKA_133820Help
Entry
PBANKA_133820     CDS       T01111                                 

Definition
(RefSeq) beta-hydroxyacyl-ACP dehydratase, putative
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
pbe  Plasmodium berghei
Pathway
pbe00061  Fatty acid biosynthesis
pbe00780  Biotin metabolism
pbe01100  Metabolic pathways
pbe01212  Fatty acid metabolism
Module
pbe_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pbe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PBANKA_133820
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PBANKA_133820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pbe01004]
    PBANKA_133820
Enzymes [BR:pbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PBANKA_133820
Lipid biosynthesis proteins [BR:pbe01004]
 Fatty acid synthase
  Component type
   PBANKA_133820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas
Motif
Other DBs
NCBI-GeneID: 3426806
NCBI-ProteinID: XP_678232
LinkDB All DBs
Position
13
AA seq 229 aa AA seqDB search
MMKLFIIFVYVLFPVLSLGVKRKGFNFLFPSFEHFNKKNNLKKSNNGINKNDSINIYINN
IEKDDNISAKIISSNITPNLNSEIIDIDQIKNILPHRYPFLLVDKVLYIQPNKKIIGIKN
VTTNEHFFNGHFPQKPIMPGVLQIEALAQLGGILCLKNSEKKSKDNLFLFAGVDGVKWKK
PVLPGDTLVMEVEQILFKPALGIAKLKGVGYVGNNVVIEIEKMIFAMSK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaactttttataatttttgtttacgtcctttttccagtattgtccttgggtgta
aaaaggaaaggcttcaattttttattcccatcctttgagcattttaataaaaaaaataat
ttaaaaaaatcaaataatgggataaataaaaatgatagtataaatatatatattaataac
attgaaaaagatgataacattagtgcaaaaataatttcatctaatattacaccaaattta
aattccgaaataattgatattgatcaaataaaaaacatacttccccatagatatccattt
ctattagtagataaagtattatatatacaaccaaataaaaaaataattggtataaaaaat
gttacaacaaatgaacatttttttaatggtcattttcctcaaaaaccaattatgcctggt
gttctccaaatagaagcattagcacaattaggtggtattttatgtcttaaaaatagtgaa
aaaaaaagtaaagacaatttatttcttttcgcaggggtagatggagttaaatggaagaaa
cccgttttaccaggcgatacattagtgatggaagtagaacaaattttgttcaaaccagca
ctcggaattgccaagttaaaaggagttgggtatgtaggtaataatgtagtaatagaaatc
gagaaaatgatttttgcaatgtcaaaatga

DBGET integrated database retrieval system