KEGG   Candidatus Promineofilum breve: CFX0092_A0312Help
Entry
CFX0092_A0312     CDS       T05438                                 

Definition
(GenBank) putative glycosyltransferase
Organism
pbf  Candidatus Promineofilum breve
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: CUS02193
UniProt: A0A170PDT0
LinkDB All DBs
Position
I:complement(351370..352806)
Genome map
AA seq 478 aa AA seqDB search
MTNALVGLYVVTVLGLAVYGLLGFCALGLFLRHRHDSGQATTPVNWQTLPAVTVQLPVYN
ERAVIGRLIAAAAALEYPRDRLQIQVLDDSTDETTALAAEAVAEYAAAGLDISLVHRANR
RGYKAGALGEGLAAARGEFIAIFDADFVPAPDFLLRTVPPLLADSAVGAVQARWGHLNDA
ESILTGAQAVALDKHFIIEQLVRFRAELFPKFNGSAGVWRRACVVDVGGWQDDTVCEDLC
LSTRAVLAGWKFYFAADVVAPAELPPTITAYKAQQARWAMGGTQCLTKYAAPICRARQTP
FARLYALLTMSAYFSNALVLLLVLVQIPLLLSEARLPVWLMPLGLAGLGQPILFALAQKT
LYPDWPTRLRRLPALLLIAFGMAPNNSWAVWRGLFSRDVVFIRTPKGQTAGYHLSPGRML
AVEVALTVYSATALFLAISLGNSGAIVFLLTAVLSFSYVALLGLRESRTPKPVAAIIS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgctctcgtggggctgtatgtggtcacggttctgggcctggccgtctatggg
ttgctggggttttgcgcgttggggcttttcctgcgccaccgccatgacagcgggcaggcg
actaccccggtgaattggcaaacgctgccggccgtcaccgtgcagctgccggtctacaac
gaacgggcggtcatcggccgcctcatcgcggccgcggcggcgctggagtacccgcgcgat
cgcttgcaaatccaggttctcgatgactcgaccgatgagacgaccgcgctggccgctgag
gctgtagccgaatacgcggcggcgggtctcgacatcagcctcgtccatcgcgccaatcgt
cgcggctacaaggccggcgcgctgggcgaaggattagccgcggcgcgcggtgaattcatc
gccatcttcgacgccgacttcgtgcccgcccccgactttctcttgcgaacagttcccccc
ttgctggccgatagcgccgtcggcgcggtgcaggctcgctggggccacctgaacgatgcc
gaatccatcctgaccggcgcgcaggccgtggcgctggacaagcatttcatcatcgagcag
ttggtgcgcttccgggccgagcttttccccaagttcaacggctcggccggcgtctggcgg
cgggcctgtgtggtggacgtgggcggctggcaggacgacacggtctgcgaagacctgtgc
ctaagcacgagggccgtcctcgccggctggaagttctacttcgccgccgacgtggtggcc
ccggccgagttgccgccgacgatcaccgcctacaaagcgcaacaggcgcgctgggccatg
ggcgggacgcaatgcctgaccaaatatgccgcgccgatctgccgggcgcgccagacgccc
ttcgcccggctctatgccctgttaaccatgtcggcctacttcagcaatgcgctcgtcctt
ctcttggtgctggtgcaaatcccgctgttgctcagcgaggcgcgcttaccggtctggctc
atgccgctgggtctggccggtttggggcagccgatcctgttcgccctggcccaaaagacc
ctctaccccgactggcccacccggctgcgacggttgcccgccctgctgctgatcgccttc
gggatggcccccaacaattcctgggcggtctggcgcgggttattcagccgtgacgtcgtc
tttatccgtacccccaaaggccagaccgccggctatcatctgtcccccggccgcatgttg
gccgtcgaagtggccctgaccgtctattcggccaccgccctgttcttggcgatctccctt
ggcaatagcggcgctatcgtctttctgctcacggccgtgctcagtttcagctacgtcgcc
ctcctcggattgagagaaagccggacccccaagccggtggcagcgataatttcctga

DBGET integrated database retrieval system