KEGG   Candidatus Promineofilum breve: CFX0092_A0954Help
Entry
CFX0092_A0954     CDS       T05438                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pbf  Candidatus Promineofilum breve
Pathway
pbf00010  Glycolysis / Gluconeogenesis
pbf00030  Pentose phosphate pathway
pbf00051  Fructose and mannose metabolism
pbf00680  Methane metabolism
pbf01100  Metabolic pathways
pbf01110  Biosynthesis of secondary metabolites
pbf01120  Microbial metabolism in diverse environments
pbf01130  Biosynthesis of antibiotics
pbf01200  Carbon metabolism
pbf01230  Biosynthesis of amino acids
pbf03018  RNA degradation
Module
pbf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pbf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFX0092_A0954 (pfkA)
   00030 Pentose phosphate pathway
    CFX0092_A0954 (pfkA)
   00051 Fructose and mannose metabolism
    CFX0092_A0954 (pfkA)
   00052 Galactose metabolism
    CFX0092_A0954 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    CFX0092_A0954 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    CFX0092_A0954 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pbf01009]
    CFX0092_A0954 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pbf03019]
    CFX0092_A0954 (pfkA)
Enzymes [BR:pbf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CFX0092_A0954 (pfkA)
Protein phosphatases and associated proteins [BR:pbf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CFX0092_A0954 (pfkA)
Messenger RNA biogenesis [BR:pbf03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CFX0092_A0954 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Vta1
Motif
Other DBs
NCBI-ProteinID: CUS02832
UniProt: A0A160T0B6
LinkDB All DBs
Position
I:complement(1092807..1095044)
Genome map
AA seq 745 aa AA seqDB search
MKRIGILTSGGDAPGMNAALRAVVRTGLNRGLEIYAIYEGYAGMVEGGDRIKPMRWSDVG
GILHLGGTIIGSARCKEFRERAGRLRATRNLLLHEIEGLVVIGGDGSLSGADVLRREWEG
LVQELVDSGQVSKKSAGRSKSLAVVGIIGSIDNDMFGSDITTGADTALHRIIEATDAISS
TAASHQRSFVVEVMGRHCGYLALMSAMASGADWVLIPESPPDVEDWESKMCEALKKGRQM
GRRDSMVIVAEGARDKNGKPITSEHVKKALEERLGEDTRITVLGHVQRGGSPSAFDRNLS
TLLGAEAVEAITTMDPAGQPLVIGMQGNKITRTPLNVALEKTRAVADAVAAKNFEEALAL
RGNSFSRSFDIVRTLVRASPHPPAPDQRRLRLAILHGGGPAPGMNTAARAAVRIGIDRGH
IILGVRNAFRGLINNEIAELNWMDVNGWATRGGSELGTNRTIPKGRDLYAIARTLEEHQI
DGILMIGGWSGYQSVLELSSQRNNYPAFDIPMVCLPATINNNLLGTELSVGADTALNSII
SAVDKIKNSAVASQRAFIVEVMGYYCGYLALMGALATGAERVYLHEEGVAMRHLVQDVED
FRHAFQHGKRLGLVIRNEMANEVYTTNFMRMLFEEEGGDLFDVRQAILGHMQQGGAPSPF
DRIFATRLAVNCVDYLEEQIARQESAGVCIGQVQGELKFTNLDEAPRQMDYDHSRPRKQW
WMDLRPIARSLASQGPIVHGEGHRG
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggatcggaatattaacgagtggcggcgacgcccccggtatgaatgcggctctg
cgggccgtggtgcgcaccgggctaaatcgcgggctggaaatctacgccatctatgagggg
tatgcgggcatggtggagggcggcgaccgcatcaagcccatgcgctggagcgacgtgggc
ggcatcctccacctcggcggcacgatcatcggctcggcgcgctgcaaggagtttcgcgag
cgggccggccggctgcgggccacgcgcaatctactgttgcacgagatcgagggcctagtg
gtcatcggcggcgacggcagcctgagcggcgcggacgtgttgcgccgcgagtgggaaggg
ctggtgcaggaactggtcgactccggccaggtcagcaagaaaagcgccggccgcagcaaa
tcgctggccgtcgtcggcatcatcggctccatcgacaacgatatgttcggcagcgacatc
accaccggcgcggacacggccctgcaccggattatcgaggctaccgacgccatctccagc
accgccgccagccaccagcgcagctttgtcgtcgaggtgatgggccgccattgtggctat
ctggccctgatgagcgccatggcctccggcgcggactgggtgctgatccctgagtcgccg
cccgacgtggaagattgggaatcgaagatgtgcgaggccctgaagaagggccgccagatg
ggccgccgcgacagcatggtcatcgtggccgagggcgcgcgcgacaaaaacggcaaaccc
atcactagcgagcacgtcaaaaaggcgctggaagagaggctgggcgaggacacccgcatc
acggtgctgggccacgtccagcgcggtggctcgcccagcgccttcgaccgcaatctgagc
acgctgctgggggccgaggcggtcgaagccatcaccaccatggaccccgccggccagccg
ctggtcatcggtatgcagggtaacaagataacccgcacgccgctcaacgtcgccctggaa
aagacccgggctgtggccgatgccgtggccgccaagaactttgaggaggcgctggcgcta
cgcggcaattcgttcagccgctcgttcgacattgtgcgcacgctcgtccgcgcctcgccc
catccgcccgcgcccgatcagcgccgcttgcggctggcgattctccacggtggcggcccg
gcgccgggtatgaacactgccgcccgcgccgccgtccgtatcggcatcgaccgcggccac
atcattctgggtgtccgcaacgccttccggggcctgatcaataacgagatcgccgaactg
aactggatggacgtcaacggctgggccacgcgcggcggctccgaactgggtaccaaccgc
accatacccaaggggcgcgacctgtacgccattgcccgcacgctggaggaacaccagatc
gacggcattctgatgatcggcggttggtcgggctatcaatcggtcctggagttgtccagc
caacgcaacaattacccggccttcgatatcccgatggtttgtttgccggcgacgatcaac
aacaacctgctgggcaccgagttgagcgtgggggccgatacggcgctcaacagcatcatc
tcggccgtggacaagatcaagaattcggccgtggcctcgcagcgggcgttcatcgtcgag
gtgatgggctactactgcggctatctggccctgatgggggcgctggcgacgggggccgag
cgggtctatctgcacgaagaaggcgtcgccatgcgccatctggtgcaggacgtggaggat
ttccgccacgccttccagcacggcaagcggctgggtctcgtcatccgcaatgagatggcg
aatgaggtctacaccaccaacttcatgcggatgctcttcgaagaagagggcggcgacctg
ttcgacgtgcgccaggccatcctgggccacatgcaacagggcggcgcgccgtcccccttc
gaccgcatcttcgccacccgtctggccgtgaattgtgtcgattatctggaggagcagatc
gcccgccaggaatcggccggcgtgtgtatcggccaggtgcagggcgaattaaaattcacc
aatctggacgaagcgccgcggcagatggattacgaccatagccggccgcgcaaacagtgg
tggatggatctgcggccgattgcccgcagcttggcctctcaggggccgattgtgcatggc
gaggggcatcgcgggtag

DBGET integrated database retrieval system