KEGG   Candidatus Promineofilum breve: CFX0092_A1384Help
Entry
CFX0092_A1384     CDS       T05438                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
pbf  Candidatus Promineofilum breve
Pathway
pbf00040  Pentose and glucuronate interconversions
pbf00051  Fructose and mannose metabolism
pbf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CFX0092_A1384
   00051 Fructose and mannose metabolism
    CFX0092_A1384
Enzymes [BR:pbf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     CFX0092_A1384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: CUS03262
UniProt: A0A160T1B6
LinkDB All DBs
Position
I:complement(1566979..1568001)
Genome map
AA seq 340 aa AA seqDB search
MKALVKSGVGPGQMSLVDIPEPSPQPGEVLIEIGATGICGTDLHIMAGEYPVRPPVVLGH
EFAGVIRELGEGVESWRVGDMVTSVPYATVCGRCVYCQAGQFGLCRHRQSYGSGVHGAFA
RYLAVNASGLYRLPANQSLAAGALTEPLACVTKAVYEIGDVRPGERVIVLGPGPIGLLAV
QVVQAAGGRVSLVGLRRDARRMAMGQALGADLTYADDPDDVTHLVNSLEPAGADVVFECS
GAGPAFDMALQVVRPQGRVIQVGLFGKRVTADLDLIVRKDLALRGSFASSLESWRRALEL
TESGLVDTSQMISDTFPLEAWADAFARAAGGEGLKVIIEP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgcttgttaaatccggcgttggcccggggcagatgagcctggtggacatccca
gagccttcgccgcaacccggcgaagttttgatcgaaatcggtgcgaccggtatctgcggc
acggatctgcacattatggccggagagtatccggtacggccgccggtagtcctcggccac
gagttcgccggcgtcattcgtgagcttggcgagggtgtcgaatcatggcgcgttggcgat
atggtaacgtcagttccctatgctaccgtctgcggccgctgcgtgtactgtcaggccggg
caattcggactttgccggcatcgccaatcgtatggcagtggcgtccacggcgcgttcgcc
agatatctggccgtcaatgcctccggcctgtatcggttgcccgccaatcagtctctggcg
gctggggcgctgaccgagccgctggcttgcgtcaccaaagcagtctacgaaattggcgat
gtgcggccgggggagcgcgtcattgtccttgggcccggccccattggcctgcttgcggtc
caggttgtgcaagcggccggtggccgtgtgtcgctggtggggttgcggcgtgatgcccgg
cgcatggcgatgggccaagccctcggcgcagatctcacctatgccgacgatcctgacgat
gttacccacctggtgaactcgctggaacccgcgggcgctgatgtggtattcgaatgttcc
ggcgccgggccggcgtttgacatggcgctacaggtcgttcggccgcagggccgcgtcatt
caggttgggctgtttggcaaacgcgtgacggccgatctcgacctgatcgtccggaaagat
cttgcgctgcggggatcgttcgcctccagcctggaatcctggcggcgggcgctggaactg
acggagagcggtttggtcgatacgagccaaatgatctccgacacattccccctggaggcg
tgggcggatgctttcgcccgcgccgccggcggagaaggtttgaaagtcatcattgagcca
tag

DBGET integrated database retrieval system