KEGG   Candidatus Promineofilum breve: CFX0092_A1406Help
Entry
CFX0092_A1406     CDS       T05438                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pbf  Candidatus Promineofilum breve
Pathway
pbf00620  Pyruvate metabolism
pbf00680  Methane metabolism
pbf01100  Metabolic pathways
pbf01120  Microbial metabolism in diverse environments
pbf01200  Carbon metabolism
Module
pbf_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pbf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFX0092_A1406 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    CFX0092_A1406 (ppc)
Enzymes [BR:pbf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CFX0092_A1406 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase pPIWI_RE_Y
Motif
Other DBs
NCBI-ProteinID: CUS03284
UniProt: A0A160T170
LinkDB All DBs
Position
I:complement(1593848..1596634)
Genome map
AA seq 928 aa AA seqDB search
MALSREKQERLSEDIHLLGDVLGHVIRRQAGIEIFELEERIRALSKTRRLEDDPAIDARL
AYVVGRLDPAEAELVARSFTTYFELVNLAEEEHRVRVLRQRERDVHPRPLPESVGAAVAA
LHGAGVDEFEMRRLLHRLHIDLVFTAHPTQAKRRTVLTRLRRISAALSDIDQRDLLPAER
QAVINQITADVTLLWVTDRSRTSRPTVTDEVRTGLFYFDNTLWEALPAVYRDLAAALGQY
YPTLQPPDRFLTFASWIGGDRDGNPNVTAAVTAETLRLHRGLALEKHRAAARALDRALSI
SSRLADVPEAVDEAVEAYGEPSGHLAFLHDRYPHETYRHLAGQLAADLAEASAGDMIARL
MGEELPPLRMRRMENLLEPLALMDRSLREAGMADIARADLELSLHQARIFGLHAARLDLR
QYSDQHTAVLDELFGRLGWFDGFATLDGPARAAALTDALARPVPNLTMLGDLSAEATEAL
ALFAILKRAVDYYGPELFGPYIVSMTHGPEDILAPLLLARWHGLCLSDDGAPEGLTFAPL
FETRADLRAAPEVMAALFDHPGYAPHLARVGRRQTIMIGYSDSNKDAGYLAANWELYGGQ
EALARACAAHDVVMTLFHGRGGTIARGGGPANRAILAQPPGSVGGRIRITEQGEVIADRY
GHPAIAARHLQQVVHAVLIAAAPDSYHLTARPKPEWRAAMEELAAVSYRAYRELIYETPE
LLVYWSQATPMDEISQMRIGSRPSRRTGAATFDSLRAIPWGFSWMQCRHVLPGWFGVGEA
LAAYSQSPAGLALLQEMYHEWPFFRNLLDNSQVSMAQADMGIARLYADLVEDGRVRDLIF
GRVSAAFAQTRAAILQTTGHRELLDNDSVLQRAVRRRNPYIDPLNFIQVSLLRRLRALPD
ADSAAAESLRDTIFLTINGIASGLKNTG
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
gtggcattgagccgagaaaaacaagagcgactgagcgaggacatccatctgctgggcgac
gtcctgggccacgtcatccggcggcaggcgggcatcgagatcttcgagctggaggaacgc
atccgcgccctgtccaagacgcgccgcctggaggacgacccggccattgacgcccggctg
gcctacgtcgtcggccgcctcgacccggccgaggccgaactcgtcgcccgtagcttcacg
acctatttcgaactggtcaatctggccgaagaggagcaccgcgtgcgcgtcttgcgccag
cgcgagcgcgacgtccacccccggccgctgccggaatcggtgggcgcggccgtggccgcc
ctgcatggcgcgggcgtcgatgaattcgagatgcgccgcctgctccaccgcctgcacatc
gacctcgtcttcaccgcccaccccacgcaggccaagcgccgcaccgttctgaccaggttg
cgccgcatctcggccgccctcagcgacatcgaccagcgcgacctgctgcccgccgagcgg
caggccgtcatcaaccagatcaccgccgacgtgaccctgttgtgggtgaccgaccgcagc
cgcacctcgcggccgaccgtcaccgacgaggtacgcaccggcctgttctacttcgacaat
actctgtgggaagcgctgccggccgtctatcgcgacctggccgccgcgctgggccaatat
tacccgacgctacagccgcccgaccgcttcctgaccttcgcctcgtggatcggtggcgac
cgcgacggcaaccccaacgtgaccgccgccgtgacggccgagacgttgcgcctgcaccgc
ggcctggccctggagaagcaccgcgccgccgcccgcgccctcgaccgcgccctcagcatc
tccagccggctggccgacgtgcccgaggcggtcgatgaggccgtggaggcctatggcgag
ccgtccggccatctggctttcctccacgaccgctacccgcatgagacctaccgccatctg
gccgggcaattagccgccgatctggccgaggcctcggccggcgacatgatcgcccgcctg
atgggcgaggagctgccgccgttgcgtatgcgtcgcatggagaacctgctggagccgctg
gcgctgatggatcgctccctgcgcgaggcgggcatggccgacatcgcccgcgccgacctg
gagctgagcctgcaccaggcgcgcatcttcggcctccacgccgcccggctcgatctgcgc
caatatagcgaccagcacacggccgtcctcgatgagctatttggccggctgggctggttc
gatggcttcgcaaccctcgacggcccggcccgcgccgcggcgctgaccgacgcattggcc
cgccccgtgcccaatctgacgatgctgggcgacctctcggccgaggcgaccgaggcgctg
gccctgttcgccatcctcaagcgcgccgtggactactacggcccggaactcttcggcccc
tacatcgtcagcatgacccacgggccggaggacatcctggccccgctattgctggcccgt
tggcatggcctgtgcctgagcgacgacggcgcgccggaggggctgaccttcgccccgcta
ttcgagacacgggctgacctaagggccgcgccggaggtcatggccgccctcttcgaccac
cccggctacgccccccatctggcccgtgtcggccgccgccagacgatcatgatcggctac
tccgacagcaacaaggatgccggctatctggccgccaactgggagctatacggcgggcag
gaggcgctggcgcgggcctgcgctgcccacgacgtggtgatgaccctcttccacggccgc
ggcggcaccatcgcccgcggcggcggcccggccaaccgcgccatcctggcccagcccccc
ggctccgtcggtgggcgcatccgcatcaccgagcagggcgaggtcatcgccgaccgctac
ggccacccggccatcgccgcccgccacttgcagcaggtcgtccacgccgtgctcatcgcc
gccgcgcccgattcgtatcatctgacggcccggccgaaacccgaatggcgggcggcaatg
gaggagctggccgccgtgtcctaccgcgcttaccgggaactgatctacgagacgccggag
ttgttggtctactggagccaggccacgcccatggacgagattagccagatgcgcatcggt
tcgcggccgtcgcgccggacgggggcggccacgttcgacagcctgcgggccatcccctgg
ggcttcagttggatgcaatgccgccacgtgctgcccggctggttcggcgtgggcgaggca
ttggccgcctatagtcagtcgccggccgggctggccctgttgcaggagatgtatcacgag
tggccgtttttccgcaatctgctcgataattcgcaagtgtcgatggcccaggccgacatg
ggcatcgcccgcctctacgccgacctggtggaggacggccgcgtgcgcgacctcatcttc
ggccgggtatcggcggcctttgcccagacgcgggcggccatcctgcaaaccaccggccac
cgcgaactgctggacaacgactcggtgctgcaacgcgccgtccgccgccgcaatccctac
atcgacccgctgaacttcattcaggtcagcctgctgcgccgcctgcgcgccctgcccgac
gccgacagcgccgcggccgaaagcctgcgcgacactatcttcctgaccatcaacggcatc
gcgtcgggcctgaagaatacgggatag

DBGET integrated database retrieval system