KEGG   Polyangium brachysporum: AAW51_0271Help
Entry
AAW51_0271        CDS       T04216                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
pbh  Polyangium brachysporum
Pathway
pbh00620  Pyruvate metabolism
pbh01100  Metabolic pathways
pbh01120  Microbial metabolism in diverse environments
pbh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AAW51_0271
Enzymes [BR:pbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     AAW51_0271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M Malate_DH
Motif
Other DBs
NCBI-ProteinID: AKJ26962
UniProt: A0A0G3BCB9
LinkDB All DBs
Position
complement(303933..306227)
Genome map
AA seq 764 aa AA seqDB search
MPTPEEKRAELRRAALEYHEFPTPGKVAIAATKQLINQRDLALAYSPGVAAACEEIVSDP
TNAFRYTSRGNLVAVVTNGTAVLGLGDIGPLAAKPVMEGKGVLFKKFAGIDVFDIELNER
DLDKLVDCIAALEPTFGGINLEDIKAPDCFYVERKLRERMKIPVFHDDQHGTAIVVGAAT
LNGLKVVGKDIRQVKLVASGAGAAALACLNLLVKLGLPRENIWVTDLAGVVYEGRTELMD
PDKAQFAQKTDKRSLAEVIEGADIFLGLSAGGVLKAPMVQRMAVKPLIFALANPTPEILP
EEVKAVRDDAIMATGRTDYPNQVNNVLCFPYIFRGALDSGATTITDEMEIAAVHAIADLA
QAEQSEVVAAAYAGATLSFGPEYLIPKPFDPRLMMRIAPAVAKAAADGGVALRPIADLDA
YREKLQSFVYASGTTMKPIFTVAKKAAHKRVVYCEGEEERVLRAVQVVVDENLARPTLIG
RPEVIRQRIERFGLRLQEGRDYDVVNTEFDHRYRDYWQTYHRMTERKGVNAQLAKIEMRR
RLTLIGAMLLHKGEVDGMICGTWGTTAMHLHYIDQVIGRRPGVNVYACMNMLMLPNRQLM
LVDTHVNYDPSAEQLAEITILAAEEMMRFGLHPKAALLSHSNFGSSNQPSAVKMRQALEL
LRVQAPWLEVDGEMHGDIAIDAEDRRELMPNSTLQGEANLLVLPNIDAANISYNLLKQTA
GGGIAIGPVLLGAAKPVHILTPSATVRRLVNMTAMTVADANAAR
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgcccactcctgaagaaaaacgtgccgagctgcgccgcgccgcactcgagtaccacgag
ttcccgaccccgggcaaggtggccatcgccgccaccaagcagttgatcaaccagcgcgac
ctggccttggcctactccccgggcgtggccgcggcgtgtgaggagatcgtcagcgatccg
accaacgccttccgctacacctcgcgcggcaacctggtggcggtggtgaccaacggcacc
gcggtgctggggctgggcgacatcggcccgctggcggccaagccggtgatggaaggcaag
ggggtgctgttcaagaagttcgccggcatcgatgtgttcgacatcgagctcaacgaacgc
gacctcgacaagctggtcgactgcattgcggcgctcgaacccaccttcggcggcatcaac
ctcgaagacatcaaggcgcccgactgcttctatgtcgagcgcaagctgcgcgagcgcatg
aagatcccggtcttccacgacgaccagcacgggacggcgatcgtggtcggcgcggccacc
ctcaacggcctgaaggtggtgggcaaggacatccgccaggtcaagctggtggcgtcgggc
gccggcgcggccgcgctcgcctgcctcaacctgctggtcaagctggggctgccgcgcgag
aacatctgggtcaccgacctggccggcgtggtctatgagggccgcaccgaactgatggac
cccgacaaggcgcagttcgcccagaagaccgacaagcgcagcctggccgaggtgatcgaa
ggcgccgacatctttctgggcctgtcggccggcggcgtgctgaaggcgccgatggtgcag
cgcatggcggtcaagccgctgatcttcgcgctcgccaacccgacgccggaaatcctgccg
gaagaggtgaaggcggtgcgcgacgacgccatcatggcgaccggccgcaccgactatccc
aaccaggtcaacaacgtcctgtgtttcccctacatcttccgcggtgcgctcgattcgggg
gctaccacgatcaccgatgagatggaaatcgcggcggtgcacgcgatcgccgacctggcc
caggccgagcagagcgaagtggtggccgccgcctacgcgggcgccacgctcagcttcggg
cccgagtacctgattcccaagcccttcgatccgcggctgatgatgcgcatcgccccggcc
gtggccaaggcggccgccgacggtggtgtcgcgttgcggccgatcgccgacctggacgcc
taccgcgagaagctgcagagcttcgtctacgcgtcgggcacgacgatgaagccgatcttc
accgtcgccaagaaggcggcccacaagcgggtcgtctattgcgagggcgaggaggaacgg
gtgctgcgggcggtgcaggtggtggtcgacgagaacctggcgcggccgacgctgatcggc
cggcccgaggtgatccgccagcgcatcgaacgcttcggcctgcggctgcaggaagggcgc
gactacgacgtggtcaacaccgagttcgaccaccggtaccgcgactactggcagacctac
caccggatgaccgagcgcaaaggtgtcaacgcgcagctggccaagatcgaaatgcgccgg
cgcctgaccctgatcggcgcgatgctgctgcacaagggcgaggtggacggcatgatctgc
ggcacctggggcacgacggcgatgcacttgcactacatcgaccaggtcatcgggcggcgc
cccggggtcaacgtctacgcctgcatgaacatgctgatgctgcccaaccggcagctgatg
ctggtcgacacgcacgtcaactacgaccccagcgccgagcagctcgccgagatcaccatc
ctcgcggctgaagagatgatgcgcttcggcctgcaccccaaggccgcgctgctgtcgcac
tcgaacttcggctcgagcaaccagccgtcggcggtgaagatgcggcaagcgctggagctg
ctgcgggtgcaggcaccctggctggaagtcgacggcgagatgcacggcgacatcgcgatc
gacgccgaagaccgccgcgaattgatgcccaacagcacgctgcagggcgaagccaatctg
ctggtgctgcccaacatcgatgcggccaacatcagctacaacctgctcaagcagacggcc
ggcggtggcattgcgatcggcccggtcttgctcggggccgccaagccggtgcacatcttg
acgccatcggccacggtgaggcgtctggtcaacatgacagcaatgacagtggccgacgca
aacgcggcgcgctga

DBGET integrated database retrieval system