KEGG   Polyangium brachysporum: AAW51_1401Help
Entry
AAW51_1401        CDS       T04216                                 

Gene name
aldB
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
pbh  Polyangium brachysporum
Pathway
pbh00010  Glycolysis / Gluconeogenesis
pbh00620  Pyruvate metabolism
pbh01100  Metabolic pathways
pbh01110  Biosynthesis of secondary metabolites
pbh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAW51_1401 (aldB)
   00620 Pyruvate metabolism
    AAW51_1401 (aldB)
Enzymes [BR:pbh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AAW51_1401 (aldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA LuxC
Motif
Other DBs
NCBI-ProteinID: AKJ28092
UniProt: A0A0G3BFJ6
LinkDB All DBs
Position
complement(1607559..1609079)
Genome map
AA seq 506 aa AA seqDB search
MDMLEPGRFGHTVDFKKRYGNFIGGAWVAPVRGEYFENLTPVTGKAFCEVPRSTAEDIEL
ALDAAHAARVGWGQRSPAERANVLWRIADRIEQNLELLATAETWDNGKPIRETLAADLPL
AVDHFRYFASCVRAQEGSIGEVDHQTMAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALA
AGNCVVLKPAEQTPTSILVLLELIADLLPAGVLNVVNGFGLEAGKPLASSKRIAKIAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVCARDDAFLDKAIEGFVMFALNQGEV
CTCPSRALIEASIYDRFMERALQRVAAIKQGNPLDKSTMIGAQASSEQLEKILSYLDLGR
QEGAECLIGGERNLLDGDLAGGYYVKPTVFKGHNRMRIFQEEIFGPVVSVTTFKDEEEAL
AIANDTLYGLGAGVWTRDMNTAFRMGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYSDQPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggacatgctcgaacccggccgtttcggccatacggtggacttcaagaagcgctatggc
aacttcatcggcggcgcctgggtggcgccggtgcgcggtgagtatttcgagaacctcacg
ccggtgaccggcaaagccttctgcgaagtgccgcgctcgaccgccgaggacatcgagctg
gcgctggacgcggcgcatgccgcccgtgtcggatggggccagcgctcgccggccgagcgc
gccaacgtgttgtggcgcatcgccgaccgcatcgagcagaacctcgaactgctggcgacg
gccgagacctgggacaacggcaagccgatccgcgaaaccctggccgccgacctgccgctg
gcggtcgaccacttccgctacttcgcctcctgcgtgcgggcccaagagggctcgatcggc
gaggtcgaccaccagaccatggcctatcacttccacgaaccgctgggtgtcgtcggccag
atcattccgtggaacttcccgctgctgatggccacctggaagctggcgccggcactggcg
gcaggcaattgtgtcgtgctcaagccggccgaacagacgccaacctcgatcctggtgctg
ctcgagctgatcgccgacctgctgccggcgggcgtgctcaacgtcgtcaacggcttcggc
ctcgaagccggcaagccgctcgcatcgagcaagcgcatcgccaagatcgccttcaccggc
gagaccaccaccgggcggctgatcatgcaatacgcgagccagaacctgatcccggtgacg
ctggagctgggcggcaagtcgcccaacatcttcttcgccgacgtgtgcgcgcgcgacgac
gcctttctggacaaggcgatcgaaggtttcgtgatgttcgcgctgaaccagggtgaggtg
tgcacctgcccgtcgcgggcgctgatcgaggcctcgatctatgaccgcttcatggagcgc
gccttgcagcgtgtggcggcgatcaagcagggcaacccgctcgacaagagcacgatgatc
ggcgcgcaggcgtcgagcgagcagctcgagaagatcctgagctatctcgacctggggcgc
caggagggcgccgagtgtttgatcggcggcgagcgcaacctgctcgacggtgatctggcg
ggtggctactacgtcaagcccaccgtgttcaagggccacaaccgcatgcgcatcttccag
gaggagatcttcggcccggtggtctcggtgaccaccttcaaggacgaggaggaggcgctc
gcgatcgccaacgacaccctctacggcctcggcgcgggtgtctggacgcgcgacatgaac
accgccttccggatggggcgcggcatccaggcaggccgggtgtggacgaactgctaccac
gcctacccggcccacgccgccttcggcggctacaagcagtcgggcatcgggcgcgaaacg
cacaagatgatgctcgaccactaccagcagaccaagaacctgttggtgagctacagcgac
cagccgctgggcttcttctga

DBGET integrated database retrieval system