KEGG   Polyangium brachysporum: AAW51_1580Help
Entry
AAW51_1580        CDS       T04216                                 

Gene name
sdhA
Definition
(GenBank) fumarate reductase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pbh  Polyangium brachysporum
Pathway
pbh00020  Citrate cycle (TCA cycle)
pbh00190  Oxidative phosphorylation
pbh00650  Butanoate metabolism
pbh01100  Metabolic pathways
pbh01110  Biosynthesis of secondary metabolites
pbh01120  Microbial metabolism in diverse environments
pbh01130  Biosynthesis of antibiotics
pbh01200  Carbon metabolism
Module
pbh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pbh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pbh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AAW51_1580 (sdhA)
   00650 Butanoate metabolism
    AAW51_1580 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AAW51_1580 (sdhA)
Enzymes [BR:pbh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AAW51_1580 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     AAW51_1580 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-ProteinID: AKJ28271
UniProt: A0A0G3BLP3
LinkDB All DBs
Position
1793838..1795544
Genome map
AA seq 568 aa AA seqDB search
MRASLQLSMAGLNVAVLTKVFPTRSHTVAAQGGIGASLGNMSEDNWHYHFFDTVKGSDWL
GDQDAIEFMCREAPKVVYELEHFGMPFDRNPDGTIYQRPFGGHTANYGEKPVQRACAAAD
RTGHALLHTLYQQNVKARTNFFVEWMALDLIRDAEGDVVGVTALEMETGEVYILEAKTVL
LATGGAGRIFAASTNAFINTGDGLGMAARASIPLEDMEFWQFHPTGVAGAGVLLTEGCRG
EGAILRNANGERFMERYAPTLKDLAPRDFVSRSMDQEIKEGRGCGPNKDYVLLDMTHLGA
ETIMKRLPSVFEIGHNFANVDITKEPIPVVPTIHYQMGGIPTNVYGQVVVPKNGAPNDIV
NGLYAVGECSCVSVHGANRLGTNSLLDLVVFGRAAGNHIVDYNLKNKSHKPLPKDAADQT
LARLARLDTAVNGEYSQDVANDIRRTMQAHAGVFRTQASMDEGVKKILEVTERVKSIGLQ
DKSKVFNTARVEALEVENLIEAAKATMISAAARKESRGAHAHNDFPNRDDANWIKHSLFY
TEGNRLDYKPVNMKPLTVESIPPKVRTF
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgtccctgcaactgtcgatggccgggctgaacgtcgcggtcctgaccaaggtg
ttcccgacccgttcgcacaccgtggcggcgcagggcggcatcggcgcgtcgctgggcaac
atgtccgaggacaactggcactaccacttcttcgacaccgtcaagggctcggactggctg
ggcgaccaggacgccatcgagttcatgtgccgcgaagcgcccaaggtcgtgtacgagctc
gagcacttcggcatgccgttcgaccgcaaccccgacggcaccatctaccagcgcccgttc
ggcggccacaccgccaactacggtgaaaagccggtgcagcgcgcttgcgccgcagccgac
cgcaccggccacgcgttgctgcacacgctgtaccagcaaaacgtcaaggctcgcaccaac
ttctttgtcgagtggatggcgctcgacctgatccgcgacgccgaaggcgacgtggtgggc
gtgaccgcgctcgaaatggagaccggcgaggtctacatcctcgaagccaagacggtgctg
ctggccaccggcggtgcgggccgcatcttcgcggcctcgaccaacgccttcatcaacacc
ggtgacggcctgggcatggcggcgcgtgcgtcgatcccgctcgaagacatggagttctgg
cagttccacccgaccggcgtcgccggcgccggcgtgctgctgaccgaaggctgccgcggc
gaaggcgcgatcctgcgcaacgccaacggcgagcgcttcatggagcgttatgcgccgacg
ctgaaagacctggcgccgcgcgacttcgtgtcgcgctcgatggaccaggagatcaaggaa
ggtcgcggctgcggtcccaacaaggactacgtgctgctcgacatgacccacctgggcgcc
gagacgatcatgaagcggctgccctcggtgttcgagatcggccacaacttcgccaacgtc
gacatcaccaaagagccgatcccggtcgtgcccaccatccactaccagatgggtggcatc
ccgaccaacgtctacggccaggtggtggtgcccaagaacggcgcgccgaacgacatcgtc
aacggcctctacgccgtgggcgagtgctcctgcgtcagcgtgcacggcgccaaccggctg
ggcaccaactcgctgctcgacctggtggtgttcggccgcgccgccggcaaccacatcgtc
gactacaacctgaagaacaagtcgcacaagccgctgcccaaggacgccgccgaccagacc
ctggcccgtttggcgcgcctggacacggcggtcaacggcgagtactcccaggatgtggcc
aacgacatccgccgcaccatgcaagcgcatgccggcgtgttccgcacccaggccagcatg
gacgaaggtgtgaaaaagatcctggaagtgaccgagcgcgtgaagagcatcggcttgcag
gacaagtccaaggtgttcaacaccgcccgcgtcgaagcgctggaagtcgagaacctgatc
gaagccgcgaaggcgacgatgatctcggcggcggcgcgcaaggaaagccgtggcgcccac
gcgcacaacgacttccccaaccgcgacgacgccaactggatcaagcactcgctgttctat
accgagggcaaccgtctcgattacaagccggtcaacatgaagccgctgacggtggagtcc
attccgccgaaggtccgcaccttctga

DBGET integrated database retrieval system