KEGG   Polyangium brachysporum: AAW51_2997Help
Entry
AAW51_2997        CDS       T04216                                 

Gene name
fabB
Definition
(GenBank) 3-oxoacyl-ACP synthase
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
pbh  Polyangium brachysporum
Pathway
pbh00061  Fatty acid biosynthesis
pbh00780  Biotin metabolism
pbh01100  Metabolic pathways
pbh01212  Fatty acid metabolism
Module
pbh_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pbh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AAW51_2997 (fabB)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AAW51_2997 (fabB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pbh01004]
    AAW51_2997 (fabB)
Enzymes [BR:pbh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     AAW51_2997 (fabB)
Lipid biosynthesis proteins [BR:pbh01004]
 Fatty acid synthase
  Component type
   AAW51_2997 (fabB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKJ29688
UniProt: A0A0G3BNX5
LinkDB All DBs
Position
3499827..3500855
Genome map
AA seq 342 aa AA seqDB search
MSTYPLAFHRTGLVTAVGLEAASACAAMRCKLTNPSETRFIDSRGEWIMAHQVPLEQPWL
GRAKLAKMAAMAIREALSDVPAVDWPNIPLLLCVAEKERPGRTDGLDDTLPRDIERELGQ
CFDARSAVVPHGRVAVAVALSQARALIYQQRVPYVLIAAADSLLSWPTLSHYDQRRRLLT
ATNSNGFLPGEGAGALLVGQPSGSSFELHCQGLGFAVEDAHIDSEEPLRAEGLTQAVKHA
LAEAGCEMHDIDYRITDLSGEQYYFKEAALALARTLRRRKEEFDLWHPAECTGEAGALAG
AAVIALADAAGRKGYTRGPAILAHMANDGGQRAALALHFRST
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctaccccctcgcctttcaccgcaccgggctcgtgaccgcggtcggcctcgaa
gccgcgtcggcttgcgctgcaatgcgctgcaagctcaccaacccgagcgaaacccgcttc
atcgactcgcgcggcgagtggatcatggcccaccaggtgccgctcgagcagccgtggctg
ggccgggccaagcttgccaagatggcggcgatggcgatacgcgaggccttgagcgacgtg
cccgccgtcgactggccgaacatcccgctgctcttgtgcgtggccgagaaggagcgcccc
gggcgcacggatggactggacgacacgctgccgcgcgacatcgagcgtgaactcggtcag
tgcttcgacgcacgctcggccgtcgtgccgcacggacgggtggcggtcgctgtcgcgctg
tcgcaggcccgcgccttgatctaccagcaacgtgtgccctacgtcctgatcgctgcagcc
gacagcctgctcagctggcccacgctctctcattacgaccagcgacggcgtttgctgacg
gcgaccaactcgaatgggttcctcccgggcgaaggcgccggtgccctgctggtcggccag
cccagcggatcatcctttgagctgcactgccaaggactcggcttcgcggtggaggacgcc
cacatcgactccgaagaaccgttgcgggccgaggggctgacgcaggccgtcaagcacgcg
ctcgccgaggccggttgcgagatgcacgacatcgactaccgcatcaccgacctctcgggc
gagcagtactacttcaaggaggcggcactggcactggcgcgcaccttgcggcgccgcaag
gaagagttcgacctgtggcatccggccgaatgcaccggcgaggcgggcgcgctggccggc
gcggccgtcatcgccttggccgacgccgcgggccgcaagggctacacgcgcggcccggcg
atcctggcccacatggcgaacgacggcggccagcgcgcggccctcgcccttcacttcagg
agcacctag

DBGET integrated database retrieval system