KEGG   Polyangium brachysporum: AAW51_3065Help
Entry
AAW51_3065        CDS       T04216                                 

Gene name
treS
Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pbh  Polyangium brachysporum
Pathway
pbh00500  Starch and sucrose metabolism
pbh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AAW51_3065 (treS)
Enzymes [BR:pbh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AAW51_3065 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AAW51_3065 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AKJ29756
UniProt: A0A0G3BQS6
LinkDB All DBs
Position
3583968..3585599
Genome map
AA seq 543 aa AA seqDB search
MAEHWYKNAIIYCLDVKTFADGNGDGIGDFVGLRDKLDYLAGLNVDCVWLQPFYPSPMRD
NGYDIVDYYNVDPRLGTLGDFVEFSRRARDRGMRVMIDLVVNHTSIDHPWFQSARRDASS
PYRDYYVWSEDKPADAGEGMVFAGEQTTTWTWDREAKAYYFHRFYDHQAELNISSPLVRR
EIEKITGFWLQLGVTGFRIDALPFLIELKGLPSEGQQDPHDYLRELRQHVQTLCGDACLM
AEANLPPEEVPNYFGDGDKIHMSFNFWLNQHLFLALARKDGRPVRQAWEQLPPLPRNCQW
NNFLRSHDELDLGRLTDAERQEVFAAFGPEPDMQLYGRGIRRRLAPMLGNDRRRLELCHS
LMLTLPGTPVLRYGDEIGMGDDLGLPDRESVRTPMQWSADDNGGFSQAPPERLALPPVGE
GEFGYASVNVEAQRRDPQSLLNWLERMTRRRKETSEFGLGEFSWIETDKPELLAHRCDLD
TSTVFAVHNFSPRRQKFSLPIGPGVNCVHDVLADHRHEVTEDGHYRCELEPYGYRWLRAR
RAG
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcactggtacaagaacgcgatcatctactgcctggatgtcaagacgtttgca
gacggcaacggcgacggcatcggcgacttcgtcgggctgcgcgacaagctcgactacctg
gccgggctgaacgtcgattgcgtctggctgcagcccttctatccctcgccgatgcgggac
aacggctacgacatcgtcgactactacaacgtcgacccgcgcctcggcacgctgggggac
ttcgtcgagttctcgcgccgcgcccgcgaccgcggcatgcgcgtgatgatcgacctggtg
gtcaaccacacgtcgatcgaccacccgtggttccagtcggcccggcgtgacgcctcatcg
ccgtaccgcgactactacgtctggtccgaagacaagcccgccgacgccggcgaaggtatg
gtcttcgccggcgagcagaccaccacctggacctgggaccgcgaggccaaggcctattac
ttccaccgcttctacgaccaccaggccgagctcaacatctcgagcccgctggtgcgccgc
gagatcgagaagatcaccggcttctggctgcagctcggcgtgaccggctttcgcatcgac
gccctgccgtttctgatcgaactcaagggcctgccgtccgaaggtcagcaagacccgcat
gactatttgcgcgagctgcgccagcatgtgcagaccttgtgcggcgacgcctgcctgatg
gccgaggccaacctgccgccggaggaggtgccgaactacttcggcgacggcgacaagatc
cacatgtcgttcaacttctggctcaaccagcacctgttcctcgcgctggcccgcaaagac
ggccggcccgtgcggcaggcctgggagcagttgccaccgttgccgcgcaactgccagtgg
aacaacttcttgcgcagccacgacgagctggacctgggccggctcaccgacgccgaacgt
caggaagtgttcgccgccttcggcccggagcccgacatgcagctctacggccgtggcata
cgccgtcgcctggcccccatgctcggcaacgaccgccgtcggctcgagctgtgccatagc
ctgatgctgaccttgcccggcacaccggtgctgcgctacggcgacgagatcggcatgggc
gacgacctcggcctgcccgaccgcgaatcggtgcgcacgccgatgcaatggagcgccgac
gacaacggcggcttctcgcaggctccgcccgaacggctggccttgccgccggtcggcgaa
ggcgagttcggctatgccagcgtgaatgtcgaagcccagcgccgcgacccgcaatcgctg
ctgaactggctcgagcgcatgacacggcggcgcaaggagacgtccgagttcgggctgggc
gagttcagctggatcgagaccgacaagcccgagctactggcccaccgctgcgatctcgac
acatcgaccgtgttcgcggtgcacaacttctcgccgcggcggcagaagttctcgctgccc
atcggccccggcgtgaactgcgtccacgacgtgctggccgaccaccgccacgaggtgacc
gaagacggccactaccggtgcgaactggaaccctacggctaccgctggctgcgcgcgcgc
cgcgcgggttga

DBGET integrated database retrieval system