KEGG   Polyangium brachysporum: AAW51_4408Help
Entry
AAW51_4408        CDS       T04216                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pbh  Polyangium brachysporum
Brite
KEGG Orthology (KO) [BR:pbh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AAW51_4408 (ahpF)
Enzymes [BR:pbh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AAW51_4408 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA Glutaredoxin HI0933_like FAD_oxidored FAD_binding_3 Thi4 FAD_binding_2 DAO K_oxygenase AlaDh_PNT_C FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AKJ31099
UniProt: A0A0G3BNR9
LinkDB All DBs
Position
5215375..5216934
Genome map
AA seq 519 aa AA seqDB search
MLDDSLKAQLKSYLERVTQPIEIVAALDETPASQEMQGLLRDIESLSDKITLKLDDDRKD
VRRPSFSLQRAGTAMDLRFAAIPMGHEFTSLVLALLQVGGHPPKVSEELISQVQGLQGDF
RFEVFMSLTCHNCPDVVQALNLMAVLNPNVHVVTVDGALFREEVERREIMAVPMIFLNGQ
PFGQGRMDLDEIVSKLDTNRAARDAAALSAKAPYDVLIVGGGPAGAAASVYAARKGIRTG
VVAERFGGQVMDTLGIENYISVLATDGPKFAQALESHASAYGVEIMNLQRGEKLIPPSQP
GELIQVQLANGGVVRGRTVILSTGARWRNVNVPGEQEYRNKGVAYCPHCDGPLFKGKKVA
VIGGGNSGVEAAIDLAGIVEHVTLIEFADQLKADAVLVKKLHSLPNVTVHTNAQTTEING
DGSKVTGLTFKDRATEELRQVPLAGVFVQIGLVPNTEWLKGTIELSRFGEIVVDAKGQTS
VPGVFAAGDATTVPYKQIVIAAGDGAKAALSAFDHLIRG
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgacagcctgaaagcccagttgaagtcttacctggagcgcgtgacccagccg
atcgagatcgtggcggcgctggacgagacgcccgcctcgcaggagatgcagggtctgctg
cgtgacatcgagtcgctgtccgacaagatcacgctgaagctcgacgacgaccgaaaagac
gtgcgacgcccctcgttcagcctgcaacgtgccggcaccgcgatggacctgcgctttgcc
gccatcccgatgggccacgagttcacctcgctggtgctcgcgctgctgcaagtcggcggc
cacccgcccaaggtgagcgaggagctgatcagccaggtgcagggcctgcagggcgacttc
cgcttcgaggttttcatgtcgctgacctgccacaactgcccggacgtggtgcaggcgttg
aacctgatggccgtgctcaacccgaacgtgcacgtcgtgaccgtcgatggcgcgctgttc
cgtgaggaggtcgagcgccgcgagatcatggcggtgccgatgatcttcctgaacgggcag
ccattcggccagggccggatggacctcgacgagatcgtctccaagctcgacacgaaccgt
gcggcccgcgacgccgcagccctgtcggccaaggcgccgtatgacgtgctgatcgtcggc
ggcgggccggctggcgcggcggcctcggtatatgcagcacgcaaaggcatccgcaccggc
gtggtggcggagcgcttcggcggccaggtgatggacacgctgggcatcgagaactacatc
tcggtgctggccaccgacgggccgaagtttgcgcaggcgctcgaatcgcacgcgagtgcc
tatggtgtcgagatcatgaatctgcagcgcggcgagaagttgattccgccgtcgcagccg
ggcgagctgatccaggtgcaactggccaacggcggtgtcgtgcgcggccgcaccgtgatc
ctgtcgaccggcgcgcggtggcgtaatgtcaacgtgcccggcgagcaggagtaccgcaac
aagggcgtggcctactgcccccattgcgacggcccgctgttcaagggcaagaaggtggcc
gtgatcggcggcggcaactcgggtgtggaagccgcgatcgatctggccggcatcgtcgaa
cacgtgacgctgatcgagttcgccgaccagttgaaggccgacgcggtgctggtgaagaag
ctgcacagcctgcccaacgtgacggtgcacaccaacgcgcagaccaccgagatcaatggc
gacggcagcaaggtcacgggcctgacgttcaaggaccgggcgaccgaggagttgcgccag
gtgccgctggccggcgtgttcgtgcagatcgggttggtgccgaacaccgaatggctgaag
ggaacgatagagctgtcgcgcttcggcgagatcgtggtcgatgcgaagggccagacctcg
gtgccgggggtgttcgcggcgggtgacgcgacgacggtgccatacaagcagatcgtcatc
gccgccggggatggggcgaaggcggcgctgagcgcgtttgatcatttgatccgcggttga

DBGET integrated database retrieval system