KEGG   Polyangium brachysporum: AAW51_4416Help
Entry
AAW51_4416        CDS       T04216                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pbh  Polyangium brachysporum
Pathway
pbh00620  Pyruvate metabolism
pbh00680  Methane metabolism
pbh01100  Metabolic pathways
pbh01120  Microbial metabolism in diverse environments
pbh01200  Carbon metabolism
Module
pbh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AAW51_4416 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    AAW51_4416 (ppc)
Enzymes [BR:pbh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AAW51_4416 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AKJ31107
UniProt: A0A0G3BNX7
LinkDB All DBs
Position
5224186..5227035
Genome map
AA seq 949 aa AA seqDB search
MPRAARPAASPAPSSSRRSATAAAAARAEDDAAEKNRPLVEDIRLLGRILGDVIREQEGK
QAYELIERIRQLSVAYRLKRDTQAGKSLDRVLKNLSGDQTVSVIRAFSYFSHLANIAEDR
HHVRRREHHERQGHLQEGSLAMTFERLAQKDVRADDVAKTLAHAYISPVLTAHPTEVQRK
SILDAERAVAELIERRDHLHTQRELDENEAMLRARVTQLWQTRMLRYSKLTVANEIENAL
SYYHATFLRQIPKLYRELEHALPGFDIPSFFRMGNWIGGDRDGNPNVTAATLELALREQS
ETALRFYLTEVHELGAELSVSALLVQVTPEMQALAERSPDTNVHRLDEPYRRALTGIYSR
LAGTLHRLTGTEALRHAVAPSTPYGSAEALLADLRTIEASLVSHHGAAMASTRLCPLIRA
VQVFGFHLATVDLRQSSDKHEAVVTELLALAKVEPRYAELSEDDKRALLLRLLNDARPLQ
VRGASYSELTESELAIFETAREMRERFGPQSIKHYIISHTETVSDLLEVLLLQKEAGLVR
GTLDDGASAALIVVPLFETIGDLRNAAPIMREFYALPGIVELVKRSGAEQDIMLGYSDSN
KDGGFFTSNWELYRAEIALVELFDGLRDEHGITLRLFHGRGGTVGRGGGPSYQAILAQPP
GTVNGQIRLTEQGEVIASKYANPEIGRRNLETLVAATLEATLLHPTKSAPKAFLEAAHEI
SNASMAAYRNLVYETPGFTDYFFAATPIREIAELNIGSRPASRKATRAIEDLRAIPWGFS
WGQCRVALPGWFGFGSAIEAFLAADPKQKKERLALLQRMYKQWPFFRTLLSNMDMVLAKS
DMGLATRYAELVEDKRLGKKIFASIQAEWQRTHDALTLITGEKRRLASNPALARSIEHRF
PYLDPLNHLQVELMRRYRQQKQAGEVSERVQRGIHISINGVAAGLRNTG
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcgccgcccgccctgccgcctcccccgccccgtcgtcctcgcgtcgcagcgcc
actgctgctgctgccgctcgcgccgaggacgatgcagccgagaaaaaccgcccgctggtc
gaagacatccgtctgctcggccgcattctcggtgacgtgatccgcgagcaggaaggcaag
caggcttacgagctgatcgagcgcatccgccagttgtcggtggcctatcggctcaagcgc
gacacgcaggcgggcaagtcgctcgaccgggtgctcaaaaatctgagcggcgaccagacc
gtgtcggtgatccgggcgttcagctatttctcgcacctggccaacatcgccgaggaccgc
caccatgtgcgccgccgcgagcaccacgaacgccagggccatttgcaggaaggctcgctg
gcgatgaccttcgagcgcctggcacaaaaagacgtgcgcgccgacgacgtcgccaagacg
ctggcccacgcctacatctcgccggtgctcacggcccacccgaccgaagtgcagcgcaag
tccatcctggacgccgaacgcgccgtcgccgagctgatcgagcgccgcgaccacctgcac
acgcagcgtgaactcgacgaaaacgaagccatgctgcgcgcccgcgtgacgcagctgtgg
cagacccgcatgctgcgctactcgaagctgacggtggccaacgagatcgagaacgcactc
agctactaccacgccaccttcttgcgccagatcccgaagctgtatcgcgagctcgagcac
gccctgcccggcttcgacatcccgtcgttcttccgcatgggcaactggatcggcggcgac
cgcgacggcaaccccaacgtgaccgcggccacgctggaactggccttgcgcgaacagagc
gagaccgcactgcgcttctatctgaccgaggtgcacgagctgggtgccgagctgtcggtg
tcggcgctgctggtgcaggtcacgcccgagatgcaggcactggccgagcgctcgcccgac
accaatgtgcaccgcctcgacgagccctaccgccgcgcgctgaccggcatctactcgcgc
ctggccggtacgctgcaccgcctgaccggcaccgaggcgctgcgccacgcggtggcaccg
tccaccccctatggctcggccgaagcgttgctggctgacctgcgcaccatcgaagcgtcg
ctggtctcgcaccacggcgcggcgatggccagcacccggctgtgcccgctgatccgagcg
gtgcaggtgttcggcttccatctcgccaccgtcgacctgcggcaaagctccgacaagcat
gaggcggtggtcaccgagctgctggcgctggccaaggtcgagccgcgctacgccgagttg
agcgaagacgacaagcgcgccctgctgctgcggctgctcaacgacgcccgcccgctgcag
gtgcgcggcgccagctattctgaactgaccgaaagcgaactggccatcttcgagacggcg
cgcgaaatgcgcgagcgcttcggcccgcagtcgatcaagcactacatcatcagccacacc
gagacggtcagcgacctgctcgaagtgctgttgctgcagaaagaagccggccttgtgcgc
ggcacgctggatgacggcgcgagcgccgcgctgatcgtcgtgccgctgttcgagaccatc
ggcgacctgcgcaatgccgcgcccatcatgcgcgagttctatgcgctgcccggcatcgtc
gagctggtcaagcgctcgggcgccgagcaggacatcatgctgggctacagcgacagcaac
aaggacggcggcttcttcaccagcaactgggagctgtaccgcgccgagatcgcactggtc
gaactgttcgacggcctgcgcgacgaacacggcatcacgctgcgtttgttccatggccgc
ggcggcaccgtcggccgtggcggcggccccagctaccaggccatcctggcgcaacccccg
gggaccgtgaacggccagatccgcctcaccgagcagggcgaggtgatcgcgtcgaagtac
gccaaccccgagatcgggcgccgcaacctcgagaccctggtggcggccacgctggaagcg
accctgctgcacccgaccaagagcgcgcccaaggccttcctcgaggcggcccacgagatc
tcgaatgccagcatggccgcctaccgcaacctggtctacgagacccccggctttaccgat
tacttcttcgccgccacgccgatccgcgagatcgccgagctgaacatcggctcgcgcccg
gcctcacgcaaggccacgcgcgcgatcgaagacctgcgtgccatcccctggggcttctcg
tggggccagtgccgcgtggcgctgccgggctggttcggcttcggctcggccatcgaggcc
ttcctggcggccgaccccaagcaaaagaaagaacgcctggcgctgttgcagcgcatgtac
aaacaatggccgttcttccgcacgctgctgtccaacatggacatggtgctggccaagagc
gacatgggcctcgccacgcgttatgccgagctggtcgaagacaagcggctgggcaaaaag
atctttgccagcatccaggccgagtggcagcgcacccacgatgcgctgaccttgatcacc
ggcgaaaaacgccggctggcctccaacccggcgctggcacgttcgatcgagcaccgcttc
ccttacctcgacccgctcaaccacctgcaggtggaactgatgcgccgctaccggcagcag
aagcaggccggcgaggtgagcgaacgggtgcagcgcggcatccacatctcgatcaacggc
gtggccgcaggcctgcgcaacaccggctga

DBGET integrated database retrieval system