KEGG   Polyangium brachysporum: AAW51_5057Help
Entry
AAW51_5057        CDS       T04216                                 

Gene name
rbcS
Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pbh  Polyangium brachysporum
Pathway
pbh00630  Glyoxylate and dicarboxylate metabolism
pbh01100  Metabolic pathways
pbh01120  Microbial metabolism in diverse environments
pbh01200  Carbon metabolism
Module
pbh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:pbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AAW51_5057 (rbcS)
Enzymes [BR:pbh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AAW51_5057 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AKJ31748
UniProt: A0A0G3BUQ3
LinkDB All DBs
Position
5913793..5914233
Genome map
AA seq 146 aa AA seqDB search
MMTNPTGRLTQGQFSFLPDLTDAEIALQIEYGLNRGYAWSVEYTDDPHPRNTYWEMFGHP
MFDLRDAAGVLMELNHCRKTFPRHYIRLLAFDSTRGVESVAMSFIVNRPAVEPGFGTERQ
EGPGRTLRYTARAYSARSPEGERYGQ
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaacccgaccgggcgcttgacccagggccagttcagctttctgcccgacctg
accgacgccgagatcgcgctgcagatcgagtacggcctcaaccggggttatgcctggagc
gtcgaatacaccgacgatccgcatccgcgcaacacgtattgggagatgttcggccacccg
atgttcgacctgcgcgacgcggccggcgtgctgatggagttgaaccactgccgcaagacc
ttcccgcgccactacatccgcttgctggccttcgactcgacccggggtgtcgaaagtgtc
gcgatgagcttcatcgtcaaccgtccggcggtcgaacccggcttcggcaccgagcgccag
gaaggcccgggccgcaccttgcgctacaccgcgcgcgcctactcggcgcgctcgcccgaa
ggggagcgttatggccagtga

DBGET integrated database retrieval system