KEGG   Polyangium brachysporum: AAW51_5244Help
Entry
AAW51_5244        CDS       T04216                                 

Gene name
ddl
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pbh  Polyangium brachysporum
Pathway
pbh00473  D-Alanine metabolism
pbh00550  Peptidoglycan biosynthesis
pbh01100  Metabolic pathways
pbh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pbh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AAW51_5244 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AAW51_5244 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AAW51_5244 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pbh01011]
    AAW51_5244 (ddl)
Enzymes [BR:pbh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AAW51_5244 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:pbh01011]
 Precursor biosynthesis
  Amino acid ligase
   AAW51_5244 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST ATP-grasp_4 ATP-grasp GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: AKJ31935
UniProt: A0A0G3BZG5
LinkDB All DBs
Position
6129691..6130602
Genome map
AA seq 303 aa AA seqDB search
MSRKSAHEVAQALRASFAEVHEFELDGQQLYQRLAQFRPDVVFPVLHGPPGEDGTLQGFL
EVLGLPYVGSSVCASACAMNKYVAKQLYRAVGLPVARDMLLPRHDTDVRQAAQHLFEQFP
SGAVVKPVDQGSAIGVAFATQPAEIEEALRNCYGVSSAALVEERINGREITAGVLELDAM
VPLPVIEIRPIGGWYDFEHRYAVGGSEHVIPAPIDAQAYAAVQDIAVRAHAALGCRDLSR
SDFLVGEDGTVTLLETNTLPGMTATSLYPDAARAAGISFEQLVRDLALKAYGRWTSVSGS
SLP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccgcaagtcggctcacgaagtggcgcaagcgctgcgcgccagctttgctgaggta
cacgagttcgagctggatggacagcagctataccagcggcttgcgcagttccgtccggac
gtggtgttcccggtcctccatggaccccctggcgaagacggaacacttcaaggcttcctc
gaggtgctgggcctgccgtatgtgggctccagcgtgtgcgcgtcggcctgcgccatgaac
aagtacgtggccaagcagttgtaccgcgcggtcggtctccccgtcgcgcgagacatgctg
ctcccgcggcacgacacggacgtgcgccaggcggcgcaacacctgttcgagcagtttccc
tcgggcgcggtggtcaagccggtggatcaggggtcggcgatcggcgtcgcgttcgccact
cagccggccgaaatcgaggaggcgctgcgcaactgctatggcgtctcctcggcggcgctg
gtggaggagcggatcaacgggcgcgaaatcaccgccggcgtgctcgagctcgacgcgatg
gtccccttgccggtgatcgagatccgcccgatcggcggctggtatgacttcgagcatcgc
tacgcggtgggcggaagcgagcacgtgattccggcgccgatcgacgcccaggcctatgcc
gcggtgcaggacatcgccgtgcgcgcgcatgcggcgctcggctgccgcgacctgtcgcgt
tcagatttcttggttggcgaggacggtaccgtgacgctactggaaaccaacaccctgccc
ggcatgaccgccaccagcctttatcccgacgcagcgcgtgcggcgggcatctcgtttgaa
cagctggtgcgggacctggccctgaaggcgtatgggcgctggaccagcgtcagcggttct
tcacttccttga

DBGET integrated database retrieval system