KEGG   Python bivittatus (Burmese python): 103048016Help
Entry
103048016         CDS       T03091                                 

Gene name
GYS1
Definition
(RefSeq) glycogen [starch] synthase, muscle
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00500  Starch and sucrose metabolism
pbi01100  Metabolic pathways
pbi04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103048016 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103048016 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pbi01003]
    103048016 (GYS1)
Enzymes [BR:pbi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     103048016 (GYS1)
Glycosyltransferases [BR:pbi01003]
 Polysaccharide
  Storage polysaccharide
   103048016 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 103048016
NCBI-ProteinID: XP_007435590
LinkDB All DBs
Position
Unknown
AA seq 732 aa AA seqDB search
MPLARSLSVTSLSGLEDWEDELDLDNAILFEVAWEVANKVGGIFTVIQTKAKITLDEWGE
NYFLIGPYLELNVRTQVELIEPPNPAIRRTIDSMNTKGCKVYFGRWLIEGGPYVILIDIG
ATAWSLDRWKTELWESCSIGIPWYDREANDAVLFGFLTAWFLGEFSAQCEEKPFIIGHFH
EWLAGVGLFLCRIRKLPIATIFTTHATLLGRYLCAGSVDFYNNLQNFNVDKEAGDRQIYH
RYCMERAAVHCTHVFTTVSQITAVEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTIFFFIAGRYEYSNKGADIFLEALARLNYLLRVNGSQI
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANAVKEKFGKKLYESLLVGNLPDMNKML
DKEDFTMMKRAIFATQRHSFPPICTHNMLDDSTDPILNTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRALDESCTQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMYARHMALATAFPDNFTYEPHETTAAQGFRYPRPASVPPSPSISRHSSPHHSETE
EDDERYDEEEEAEKDRQNIKPPAMMGPVPEWRKRSKKGSSEASTSSNASTPTLPSSPSDL
SSPTSSLIEEKN
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgccactggcccgcagcctgtcagtgacctccctgtctgggttagaggactgggaagat
gaacttgacctggataacgccattcttttcgaagtggcttgggaggtggccaataaagtt
ggtgggatcttcactgttatccagacaaaagccaagattacactggatgagtggggtgag
aattacttcctgattggaccttacctagaattgaatgtgcgcacacaggtggagctgata
gaacctcccaaccctgccattcgccgaaccattgactccatgaatacaaaaggatgtaaa
gtttattttggtcgctggctgattgaggggggaccctatgtgattctcattgatattggg
gcaactgcctggagcttggatcgctggaagactgagttgtgggaaagctgttccattggg
attccctggtatgaccgagaggctaatgacgctgtgctctttggcttcctcacagcctgg
tttctaggggagttttctgcacaatgtgaagaaaagccattcatcattggtcatttccac
gagtggttggctggtgttggactcttcctctgtcggatccggaaacttccaatagctacc
atcttcaccacccacgctaccctgcttggccgttacctgtgtgctggcagtgtggacttc
tacaacaacctgcagaattttaatgtggacaaagaggccggagaccggcaaatctaccat
cgttattgtatggagcgagctgctgtccactgcacacatgtttttaccacagtttctcag
atcacagctgtagaagctgaacatctgttaaaacggaaacctgatattgtgactcccaat
ggtctgaacgtcaagaagttctctgctatgcatgaattccaaaacctccatgcccagagc
aaagctcgtatccaagagtttgtccggggccatttctatgggcatctggacttcaatctt
gacaaaactattttcttcttcatcgctggacgctatgaatactccaacaaaggagctgac
attttcttggaagccctagccaggctcaactacctgctgagggtgaatggaagccagatt
acagtggtagcgttttttatcatgccagctaggacaaacaatttcaacgtggagacgcta
aaaggccaggccgtccgcaagcagctctgggacacagccaatgcagtgaaagagaagttt
ggcaaaaaactgtacgaatccctccttgtggggaaccttcctgacatgaacaaaatgttg
gacaaagaagatttcacaatgatgaagagagccatctttgccactcagcgccattctttc
cccccaatctgtactcacaacatgctggacgattctaccgaccccattctcaacaccatt
cggcgcatcggcctcttcaacagcagtgctgaccgtgtcaaggtcatcttccatccagaa
tttctgtcttccactagtcccttgcttccagttgactatgaagaatttgttagaggctgc
catttgggggtattcccttcttattatgagccatggggctacactccagctgaatgcact
gttatgggcatccccagcatttccaccaacctctctggctttggctgctttatggaggaa
cacatagcggatccatctgcctacgggatctacatcttggatagacgtttccgggccttg
gatgagtcgtgcacacagttgacctctttcctctacagtttctgccagcagtcacggcgg
cagcgcattatccagagaaaccgcacagagaggctttctgatctcttggattggaaatac
ctaggaaggtattacatgtatgcccggcatatggcccttgcaacggcgttccctgataac
ttcacctatgagccacatgaaacaaccgcggctcagggtttccgctacccacgcccagcc
tcggtaccaccgtctccttccatctcccgccactccagcccccatcacagcgagaccgaa
gaggatgatgaacggtatgatgaggaagaagaggcagaaaaggacaggcagaacatcaag
cccccagcaatgatgggtccagtccctgagtggcgcaagcgctccaagaaggggtctagt
gaggccagcacttcctccaatgctagcactcccaccctccccagcagccccagtgacctc
agcagccccaccagttctctgatcgaagagaagaattag

DBGET integrated database retrieval system