KEGG   Python bivittatus (Burmese python): 103048098Help
Entry
103048098         CDS       T03091                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E-like
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
pbi  Python bivittatus (Burmese python)
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103048098
Enzymes [BR:pbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103048098
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 103048098
NCBI-ProteinID: XP_007440994
LinkDB All DBs
Position
Unknown
AA seq 687 aa AA seqDB search
MAASISTNWRQSENAREHHTDQYPGTGLVLRRAQSFGITLTFTSSALAADGITFSIDRGS
SIALQAKTRVDFGISSAHSKGSWSAVQTSGPSGSLNVSIFSPANSAIGRYRLGVKTSSSS
SVSILGTFVLLFNPWVPEDEVFMPDNAERQEYVLSEFGVVFVGSTNRISHFGWNYGQFQE
DILDICLFILDRSLSHRKDPIADLRRRNDPKYVGRVLSAMVNSNDDNGVLQGNWSGNYSG
GESPSSWTGSVDILRRWKSSGFRPVRYGQCWVFAGVLNTVLRCLGMPSRTISNFNSAHDT
DMSLTVDVYYDAEGNPLNIASDSIWNFHVWNEGWFFRSDLGATYRGWQILDATPQERSSG
IFQCGPASLTAIKEGDVDLPFDSPFVFAEVNADRVTWLYDTTNGEKKMIYSETRSVGQYT
STKAVGSYTRQDVTNNYKYPEGSAKEREVFKKARGKLNLDPLLATSAKLPEKDKPISGKF
KVEKPPEVGKDVSLVLQLTNLASVARKLTANMTAWTIIYTGKPVHEVWKNTLKVDLGPKE
EKAFPIKISYAEYQQHLTADNMLRATALCQISEGKDTVVERDISLDNPSIALKVLGQAKV
GQAVKVEVNFTNPLDEELKDCILLAEGSDLLAEKLRLEVPPVKAKQNSHIHFEVTPSKDG
TKQLLINFSCDKFQDIKAFETITVAAN
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttcaatcagcaccaactggaggcagagcgagaatgcccgcgagcaccacacc
gaccagtaccctggcactgggctggttttgcgacgggcccaatcgtttgggatcacactg
accttcacgagctcagctctggctgccgacggcatcaccttctctatagacagaggctca
agcattgccctgcaggccaaaacccgagtggacttcggcatctccagcgcacacagcaaa
ggctcttggagcgcggtgcagacctcaggtccttctggctccttgaacgtctccatcttc
agcccagcaaattctgccattggacgttaccggctgggcgtcaagaccagctccagcagc
agtgtttccatcctgggcactttcgtgctgctgttcaacccttgggtgccagaggatgaa
gtgttcatgccagacaacgcagaacgtcaggaatatgtcctctcggagtttggtgttgtc
tttgtggggagcacaaaccgcatctctcactttggctggaactatgggcagtttcaagag
gacattctggacatttgtcttttcattctggaccggagcttaagccaccgcaaggatcca
attgctgatctgcgtcgccggaatgatcccaaatatgttggacgggtgctgagtgccatg
gttaacagcaatgatgacaatggcgtgttgcagggaaactggagtgggaattacagtggt
ggggaaagccccagcagctggacggggagcgtggacatcttgcgcaggtggaagagctca
ggtttcaggcccgtccgctacggacagtgttgggtctttgctggagtgctgaacaccgtc
ctccgatgtctgggaatgcccagccgcacgatctcaaacttcaactctgcccacgacacg
gacatgagcctgacggtggacgtgtactacgacgccgaggggaatcctctgaacatcgcc
tctgacagcatctggaacttccacgtgtggaacgaaggctggtttttccgatctgatctt
ggtgccacctaccgcggctggcaaattctggatgccactccacaggagaggagttcaggc
atattccagtgtggaccagcatccctgacggccatcaaggagggagatgtggacctgccg
ttcgactccccgttcgtctttgcagaggtcaacgctgaccgtgtcacctggctgtatgac
accaccaacggcgaaaaaaaaatgatttactcggagaccagatcagttggccagtacaca
agcacaaaagctgttggcagctatacccgccaggacgtcacaaacaattataaatatcca
gaaggctcagccaaggaaagggaagtcttcaaaaaggcacgtggcaagctgaaccttgac
cccctcttggccacatctgccaagctgcccgaaaaagataagcccatctcagggaagttt
aaggtggagaagcccccagaggtcggcaaggatgtcagcttggtcttgcagctgaccaac
cttgcttcggtagccaggaaactgacagccaacatgaccgcctggaccatcatctatact
ggaaagccggtccacgaggtctggaagaacaccctcaaggtggatcttgggcccaaagaa
gaaaaagcatttcccatcaagatttcctacgccgaataccagcagcacctcacagcagac
aatatgctccgtgcgactgccttgtgccagatcagtgaggggaaagacactgtggtggaa
agagacatcagtctggacaacccctcaatcgccctaaaggtgctgggccaggccaaggtg
ggccaggcggtgaaagtggaagtgaacttcaccaaccccctggacgaggagctgaaggac
tgcatcctgctggcagagggcagcgacctgctggcagagaagctcaggcttgaggtaccc
cccgtgaaggccaagcagaactcacacatccactttgaggtcactcccagcaaggacggg
acgaagcagctgctcatcaacttctcctgtgacaaattccaggacatcaaggcctttgag
accatcacggtggccgccaactga

DBGET integrated database retrieval system