KEGG   Python bivittatus (Burmese python): 103048603Help
Entry
103048603         CDS       T03091                                 

Gene name
FN1
Definition
(RefSeq) fibronectin isoform X4
  KO
K05717  fibronectin 1
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04510  Focal adhesion
pbi04512  ECM-receptor interaction
pbi04810  Regulation of actin cytoskeleton
pbi04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    103048603 (FN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103048603 (FN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103048603 (FN1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103048603 (FN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pbi04131]
    103048603 (FN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbi04147]
    103048603 (FN1)
   00536 Glycosaminoglycan binding proteins [BR:pbi00536]
    103048603 (FN1)
Membrane trafficking [BR:pbi04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    103048603 (FN1)
Exosome [BR:pbi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   103048603 (FN1)
Glycosaminoglycan binding proteins [BR:pbi00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   103048603 (FN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 Interfer-bind DUF2369 PAP_PilO
Motif
Other DBs
NCBI-GeneID: 103048603
NCBI-ProteinID: XP_007424330
LinkDB All DBs
Position
Unknown
AA seq 2290 aa AA seqDB search
MPDSRSRRPLLLVLTLCLGAGVWGSQPRAEKSRRQAQHIVQPSLPGGQNKQGCYDNGQHY
QINQQWERIYLGNTLVCTCYGGSRGFNCESKPEPEETCFDKYTGTTYRVGETYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTC
KPVAERCYDNTAGTSYVVGEVWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTKTS
YRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHSSLQATGIGSASATITDVRTALYQPQ
PQPAPYGHCVTDSGIVYTLGMQWLKAQGNQHMLCTCLGNGISCQETAVTQTYGGNSNGEP
CVFPFTYNGRTFYSCTSEGRNDGNLWCSTTSNFDQDKSYSFCTEQNVLVQTRGGNSNGAL
CHFPFLYNNRNYTDCTSEGRRDNMKWCGTTPNYDVDQKFGFCPMAAHEEICTTNEGVMYR
VGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDGITYDVNQTFHKRHEEGH
MLNCTCFGQGRGRWKCDPIDQCQDSESQTFYQIGESWEKHAHGVRYQCYCYGRGIGEWHC
QPLNTYLGSSGPVQVIITDVPIQPDSHPVQWIAPESSHISNYILRWKPKNSGVQWKEAKI
PGYLNSYTISGLKPGVLYEGQLISVQHYGQREITRFEFTTSSTTAISSSRVTGETTAPPS
VVSISESVTEITANSFVVSWVSASDTVSGFRVEYELSEDGDEPKYLDLPNTVNSVSIPNL
LPGRNYIIKVYQISEEGEQNLILSTTQTTAPDAPPDHLVESVDDTSILVRWSRPEAPITG
YRIVYTPSVEGSSTELNLPESATSVTLSDLMPGVQYNISIYAVEENQESTPIFIQQKTTG
VPRADEIHPPQHLQFLEVASDKITIMWSPPDSAVTGYRVEVIPVNRPGEHGQKLPVSRYT
FAEVTELLPGTTYLFKIYAIGQNTESEPLTGEQTTKLDGPTNLRLVNETSSTVLVTWRPP
RARIGGYQLSVQSTTGSHPKQYTVGPSATKYLLRNLQPGSEYTVSLAAVKGNQKSNPEIG
IFTTLQPTGSVPPYNTEVTETSIVVTWIPAPRIGFKLGVRPSQGGEAPREVTSESGSIVI
SGLTPGVEYIYSITVLTDGQEKDTPIVKTVVTPPSPPTNLHLDSNPDTGILTVSWKRSTT
PDITGYRITTVPTNGQQGYTLEEQVQAEHTSCIFENLSPGVEYNVSVYTLKDNQESLPVS
ETITQAVPPPTNLRFTNVGPDTVRVTWTPPASIDLSSFLVRFSPVKNKEDVAELSISPSD
NAVVLTNLLPGTAYLIKVYSVYEQHESKPLSGEQKTGLDSPTGLDFSEITAHSFTVHWIA
PRAAITGYKIRHHLEQGGGRPKEVRVAPSRNSITLTDLIPGSEYVVSVSAFYGKEESLPL
IGQQSTVSDVPRDLHVTATSPTSLVISWDAPAVTVRYYRITYGETGGSGPVQEFTVPGHV
STATIPGLKPGVDYTITVYAVTGRGDSPASSKPISVNYRIEIDTPSQLQVTDVQDNSFTV
QWQPSSSPVTGYRVTATPKDGHGPTKTRVLSAEQTEVTIDDLQPTVEYVVSVYAQGPNGE
SQPLVEKAVTTIPSPTNLKFIQVAPTSFTVTWTAPNVKLTGYRVRVNPKEKNGPMKEINL
APDSTSAVISGLMVATKYEVSIYALKDSLTSRPAQGVVNTLENVSSPRRARVTDVTERTI
TITWRTKTEAITGFQIDAVPAGGQNPVQRTVSPDVRTYTITGLQPGTDYKIYIYTLNDNA
RSSPVVIDASTAIDAPSNLRFLTTTSNSLLISWQPPRAKITGYLIRYEQVGGPTRELLPR
PRPGITEATITDLEPGTEYIIYITAVKNNQKSEPLIGRKRTDELPRLVTPPHPGKRVTDV
LDVPSVLENVPYLTNNPYDNGNGIPIPGSSGQQPFLSNPSQQVIVEEFGSRTPTTAATPG
KAKPNGEQPVVVIHHPIQVPDVDQPSYHHTLLPKNNYTKPQEALSQTTISWTPYTDSSEY
IISCQPVSAEEESTEIKVPGTYSSATLTGLTRGATYNIVVEAVKNQRRHRVLEEMVTVGN
DISERLSPPTDDACYDTFTGSFYSIGDEWERMSETGFKLWCQCLGLGSGHFRCDSSKWCH
DNGVNYKIGEKWDRQGESGQVMSCTCLGNGKGEFKCDPHEATCYDDGKMYQVGEQWQKEY
LGAICSCTCYGGQQGWRCDNCRRPGAAEGSPSQTYSQREQQSTNTQNIHCPIECFYPLHL
HSDAQNRRGD
NT seq 6873 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacagccgatcgaggcgaccgctcctcttggtgctgaccctttgtttgggggca
ggggtctggggttcgcaaccccgcgccgaaaaaagcagaaggcaggcgcagcatatcgtc
cagccctctctgccgggcggccagaacaaacagggatgctatgacaatgggcaacattat
cagataaaccaacaatgggagcgcatttacttggggaacactctagtctgtacttgctat
gggggcagccgaggattcaactgtgaaagcaagcctgagccggaagaaacctgttttgac
aaatacactggaactacttatcgagtaggggaaacctatgaacgtccaaaggattccatg
atctgggactgtacttgtattggggctggccgtggtagaatcagctgcactattgcaaat
cgctgtcatgaaggtggccagtcctacaagattggtgatacctggcgccggcctcacgag
acaggaggctacatgttagaatgtgtgtgccttggcaatgggaagggcgaatggacttgc
aaaccagttgctgagcggtgctacgataatacagctgggacatcctatgttgttggagaa
gtctgggaaaagccatatcagggctggatgatggtggattgcacttgcttaggagaaggc
agtgggaggattacttgcacttccagaaacagatgcaatgatcaggacaccaagacatcc
tacagaatcggagacacctggagcaagaaggataacagaggaaatctgcttcagtgcatc
tgcacagggaatggcagaggggaatggaaatgtgagagacattcatctttgcaagccaca
ggcataggaagtgcatctgcaactatcacagatgtacgaactgcactctaccaaccccag
ccccagcctgctccttatgggcattgtgtaactgacagtggcatagtgtatacgctggga
atgcagtggcttaaggcccagggaaaccagcatatgctttgtacttgtctgggcaatgga
atcagctgccaggaaacagctgtgacccaaacttatggtggcaattccaatggagaacct
tgcgttttcccattcacctataatggaaggactttctactcatgcacttctgaaggacgt
aatgatgggaatctctggtgcagtacaacctccaactttgaccaggataagagctactcc
ttttgtacagaacaaaatgtgttggttcaaacacgtggtggcaattccaatggtgccctg
tgtcattttcctttcctctacaataaccgcaattacactgattgtacttctgaaggacga
agagataacatgaagtggtgtggaactaccccaaactatgatgttgatcagaagtttgga
ttttgtcccatggcagctcatgaggaaatttgcacaaccaatgaaggtgttatgtatcgt
gttggagatcagtgggacaaacagcatgatatgggccatatgatgagatgcacttgtgtg
ggaaatggacgtggggaatggacctgcattgcatattcccagctcagagatcagtgtata
gttgatggaatcacatatgatgttaatcagacttttcacaaacgtcacgaagaaggacac
atgctgaactgtacatgttttggccaaggtcgagggagatggaaatgtgatcctattgac
cagtgtcaagattcagaaagccagaccttttaccagattggggagtcatgggaaaagcac
gctcatggagtgagataccagtgctattgctatggccggggtatcggagaatggcactgc
cagcctttgaatacatacctaggttcctctggtcctgtccaggtgattatcacagatgtt
ccaattcaacctgattctcatcctgtccaatggattgcacctgagtcctctcacatttcc
aattatattcttcgctggaaaccgaaaaattctggagtgcaatggaaagaagctaaaatt
ccaggctatttaaattcttacacaatctcaggtctgaaacctggtgtcctttatgaggga
cagcttataagtgtgcagcattatggccagagagaaatcacccgttttgaatttaccacc
tctagtacaacagctatttcctctagtcgtgtgacgggagaaacaacagccccaccttct
gtcgtctccatttctgaatctgtcacagaaatcacagccaatagctttgtggtctcttgg
gtttctgcctcagacactgtgtcaggatttcgggtggaatatgaactgagtgaagatggt
gatgaacctaagtatcttgatcttccaaacacagtcaattcagttagcattcccaatttg
cttccgggtcgcaactacattatcaaagtctatcaaatttcagaggaaggggagcaaaat
ctaattctttcaacaacacagacaacagcacctgatgctcctcctgatcatcttgtagaa
agtgttgatgatacttcaattcttgtcaggtggagcagaccagaagctccaatcacaggt
taccgaattgtttatactccatcggtggaaggcagcagcacggaactcaacctccccgaa
tctgctacatctgtgacactcagtgacttgatgcctggtgttcagtacaatatcagtatt
tatgctgtggaagagaaccaggaaagcactcctatcttcattcagcagaaaaccacagga
gtaccacgggcagatgagattcatcctccccagcatcttcaatttctggaagttgccagt
gacaaaattaccatcatgtggagccctcctgatagtgcagtgactggctatcgtgtagag
gttattccagttaaccgccctggagaacatggtcagaagctgcctgttagtagatataca
tttgctgaggtcacggagcttttgcctggaacaacttacctcttcaagatctatgctata
ggacaaaacacagaaagtgaaccattaactggagaacaaacaacaaaacttgatggccca
accaatttgcggcttgtcaatgagacatcctctactgtgctagtaacatggaggcccccg
cgagcccgtattggaggataccaactttctgtgcagtccaccacaggcagtcaccccaag
cagtacactgtggggccatcagccaccaagtatctgttgaggaacttgcagcctggctct
gagtataccgtgtccctagcggctgtcaagggtaaccaaaagagcaatccagaaatagga
atcttcacaacactgcagcccacaggctcagttcctccctataacactgaagtgacagag
acatccattgttgttacctggatacctgcacctagaattggttttaagctaggggtgaga
ccaagccaaggtggagaagctccaagggaggtcacctcagaatctggaagcattgttata
tctggcctaactcctggtgtggaatatatctacagcattaccgttcttacagatggtcaa
gaaaaggacacacctattgtcaagacagtagtcacaccaccatctcctcccacaaacttg
catctcgattctaaccctgacactggaatccttactgtttcttggaaaagaagcactact
ccagatatcactggatacagaattactactgtccctacaaatgggcaacaaggctacact
ctggaggagcaagttcaagcagagcatacatcctgcatttttgaaaatctgagtcctggt
gtggaatacaatgtcagtgtttacacgctcaaagataaccaagagagtttgcccgtctca
gaaaccatcacacaagctgttcctccaccgaccaatctccgtttcaccaatgtgggacct
gacactgtgagagtgacctggactccaccagcatctattgacctgagcagcttcttggtc
cgcttctcgcctgtgaagaacaaggaggatgttgcagagctttccatttcgccttcagac
aatgccgtggttttaacaaatctccttcctggcacagcatacttgatcaaggtctacagt
gtatatgagcaacatgagagtaagcctctaagtggagagcagaaaacaggccttgattct
cccactggactggatttctcagagataacagcccattctttcactgtccattggattgcc
cctcgcgctgccatcactggctacaaaatacgccatcatcttgagcagggtggaggcaga
cccaaagaagtccgtgttgcaccatctcgcaactccatcactctcacggatctgattcca
gggtcagagtatgtggtcagtgtatcagcattctatggcaaagaagagagcttgccttta
attggacagcaaagtacagtttctgatgtcccgagagatctacatgtgactgccactagc
cccactagtctggtcatctcctgggatgcacctgctgttacagtccgatactacaggatc
acgtatggagaaacaggtggtagtgggcctgttcaagagttcactgttcctggccatgtc
tccactgctacaattcctggtcttaagcctggagtggattataccattaccgtgtatgct
gtcaccgggcgcggagacagtcctgccagcagcaaacctatcagtgtcaattaccgaata
gagattgatacaccatcacagctacaagttactgatgttcaagacaacagctttactgtg
cagtggcagccttcctcttccccagttactggttacagagtgacagccactcctaaggat
ggccatggccccaccaaaactagagttctctctgcagaacaaacagaagttacaattgat
gacctgcaacctacagttgagtatgtggttagtgtctatgcccaagggccaaatggagaa
agccagcctttggttgagaaagctgttacaacaatcccatctcctacgaatctgaagttt
attcaggttgctccaacaagtttcacagtaacctggactgcaccaaatgtgaagcttact
ggatatcgagtgagagtaaatcccaaggagaagaatgggccaatgaaagaaattaacctc
gctccagatagcacatctgctgttatctctggactaatggtggcaactaaatatgaagtt
agtatctatgctctgaaggactctctgaccagcagacctgcccaaggtgtagttaatact
ctggaaaatgttagctctccccgtagggctcgtgtcacagatgtcacagagcgaaccatc
acaattacctggcgcaccaagacagaggccatcacaggtttccagatagatgctgtccct
gcaggtggtcagaatccggttcaaagaacagttagccctgatgttagaacctacaccatt
actggcttgcaacctggcactgactacaagatttacatctacacactgaatgacaatgct
cgcagctccccagtagtgattgatgcttccactgccattgatgcaccttccaatctacgc
ttcctcacaactacaagcaactccttgttgatcagttggcagccaccccgggccaagatc
acaggctacctaatcagatatgagcaagttgggggcccaaccagggagctacttcctcgt
cctcgtcctggcattaccgaggccactatcacagatctggagccagggacagaatacatc
atctatataactgctgtgaagaataatcagaagagtgaaccattgattggaaggaaaaga
acagatgagcttccccggctggtaacgccaccccatcctggcaaaagggtgacggatgtc
ttggatgtgccttctgttctggagaatgtaccttacctcacaaacaacccctatgacaat
ggaaatggtatcccaattccaggttcttctggtcagcaacccttcctgagcaacccaagt
caacaagtcattgtagaagaatttgggtctcgaacccccacaactgcagcaactccagga
aaggctaaaccgaatggggaacagccagtggtggtgatccatcatcctattcaagttcct
gatgttgaccaaccctcttatcatcatacccttctacccaagaacaattatacaaagccc
caggaagcactttctcagacaaccatctcatggacaccttatacagatagctccgagtac
attatttcttgccagcctgttagcgctgaagaagaatctactgagatcaaagttcctggc
acgtattctagtgcaactcttactggtcttactaggggggccacctacaacatcgtagta
gaagcagttaaaaatcagagaagacacagagttcttgaagagatggtcacagtgggcaat
gacatttctgaaagattaagcccgcccactgatgatgcatgttatgatactttcactggt
tctttctactctattggggatgagtgggaaaggatgtctgaaactggattcaaactctgg
tgccagtgtttaggccttggtagtggacatttcagatgtgattcttcaaagtggtgtcat
gacaatggggtgaactataagattggtgagaagtgggacaggcagggagagagcgggcag
gtgatgagctgcacttgccttggaaatggaaaaggagaattcaagtgtgaccctcatgaa
gcaacttgttatgatgatggcaagatgtatcaggtaggagagcagtggcagaaggaatat
ctcggtgctatctgctcttgtacttgctacggaggacagcagggctggcgttgtgacaat
tgccgtagacctggtgcagctgaaggttctcctagtcaaacctattcacagagagagcaa
caaagcacgaacacacagaatatccattgtccaattgaatgcttctatcccttacatcta
cactcggatgcacagaaccgacgaggagattaa

DBGET integrated database retrieval system