KEGG   Python bivittatus (Burmese python): 103049112Help
Entry
103049112         CDS       T03091                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00250  Alanine, aspartate and glutamate metabolism
pbi00410  beta-Alanine metabolism
pbi00430  Taurine and hypotaurine metabolism
pbi00650  Butanoate metabolism
pbi01100  Metabolic pathways
Module
pbi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pbi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    103049112 (GAD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103049112 (GAD1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103049112 (GAD1)
   00430 Taurine and hypotaurine metabolism
    103049112 (GAD1)
Enzymes [BR:pbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103049112 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS DegT_DnrJ_EryC1 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 103049112
NCBI-ProteinID: XP_007437339
LinkDB All DBs
Position
Un
AA seq 590 aa AA seqDB search
MATSDPSSSNTAQDPNPTNLRPTTYDTWCGVAHGCTKKIGLKICGFLQRNNSLEDKSRLV
SALKERQSSRNLLACENSEKEARFQRTETDFSNLYARDLLPAKNGEEQTVQFLLEVVDIL
LTYVKKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDNPESLEQILVDCRDTLKYGVRTGH
PRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLRKMREIIGWSNKDG
DGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAALGFG
TENVILVKCNERGKIIPADLEAKILDAKQKGYVPLYVTATAGTTVYGAFDPIQEIADICE
KYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAVLLREKGIL
QGCNQMCAGYLFQQDKQYDITYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFESQINKCL
ELSEYLYNKIKNRHEFEMVFEGEPEHTNVCFWYIPPSLRGMPDSEERREKLHRVAPKVKA
LMMETGTTMVGYQPQGEKVNFFRMVISNPAATKSDIDFLIEEIERLGQDL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggccacctcggatccctcctcctccaacaccgctcaggatcccaatccgactaattta
cgacccacaacttatgatacctggtgtggtgtagctcatggatgcacgaagaaaatcggg
ctcaagatatgcggcttcctgcaaaggaacaacagtctggaagacaagagccggctggtg
agcgcgctcaaggaacggcagagctcccggaacctgctggcttgcgagaacagcgagaag
gaagcccgcttccagaggaccgagaccgacttctccaacctctacgcccgggatttactg
ccagccaagaatggtgaagagcagacagttcagttccttctggaagtggtagacattctc
ctgacctatgtgaagaagacctttgataggtccaccaaggtgctagatttccatcaccct
catcagctcctagaaggcatggaaggcttcaaccttgagctctctgacaatccagaatca
cttgaacagatcctagtggactgcagagacactctgaaatatggagtaaggacaggtcac
cctcgctttttcaaccagctttctacagggcttgatatcattggcttggctggggaatgg
ctgacatctacagctaataccaacatgtttacgtatgaaattgcacctgtttttgtactt
atggagcaaataacgcttcgaaaaatgagagagattattggatggtccaataaagatgga
gatggaatattctcacctggtggcgctatatccaatatgtatagcatcatggccgcccgc
tataaatatttcccagaagtcaaaaccaaaggcatggctgcagtgcctaaactggtcctt
tttacttcagaacatagtcactattcaataaagaaagctggagctgcacttggttttggt
actgaaaatgtgattttggtaaagtgcaatgaaaggggcaaaataatacctgctgatcta
gaagccaaaatcctggatgccaaacaaaaggggtatgttcccctttatgtgactgcgact
gctggtacaacagtttatggagcctttgatcctattcaggagatagcagacatctgtgaa
aagtataatctttggctccatgtggatgctgcctggggaggtgggttactaatgtccaga
aagcatcgtcacaagctgaacggtatagaaagagccaactcagtcacatggaatccgcac
aagatgatgggagtcctgttgcagtgttctgccgttcttcttcgggaaaagggtatactt
caaggttgcaaccagatgtgtgcaggatatctgtttcagcaagataagcaatatgatatc
acctatgacactggagataaagcaatacaatgtgggcgccatgtggatatattcaaattc
tggttgatgtggaaagcgaagggtacagtgggatttgaaagtcagatcaacaaatgtctt
gaattgtcagaatacctttataataaaattaaaaacagacatgagtttgagatggttttt
gaaggagagcccgaacacacaaatgtttgtttctggtacattccaccaagtctcagaggg
atgccagactctgaagaaagaagagaaaaactacatagggtggcgcccaaggtcaaagct
ctgatgatggaaacaggcaccacaatggttggatatcagcctcagggagagaaagtcaac
ttcttccgaatggtgatttcaaatcctgcagctaccaagtcggatattgacttcttgatt
gaggaaatagaacgactggggcaagatctgtaa

DBGET integrated database retrieval system