KEGG   Python bivittatus (Burmese python): 103050388Help
Entry
103050388         CDS       T03091                                 

Gene name
LIG4
Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    103050388 (LIG4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pbi03400]
    103050388 (LIG4)
Enzymes [BR:pbi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103050388 (LIG4)
DNA repair and recombination proteins [BR:pbi03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     103050388 (LIG4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 DNA_ligase_A_C DNA_ligase_IV BRCT RNA_ligase LIG3_BRCT mRNA_cap_enzyme APG17
Motif
Other DBs
NCBI-GeneID: 103050388
NCBI-ProteinID: XP_007432224
LinkDB All DBs
Position
Unknown
AA seq 908 aa AA seqDB search
MASIPTSHSSSKLTVASQVPFADLCSTLERIQKCKSRSDKTRYFKDFLDSWRKFHDALHK
NEKDVIDSFYPAMRLILPQLERERMAYGIKETMLAKFYIELLNLPKDGKDALKLLNFRTP
TGSQGNAGDFAMVAYFVLKSRCISQGQLTIQQVNDLLDSISNNNAAKRKDLVKKSLLQLI
TQSSALEQKWLIRMIIKDLKLGVSQQTLFSIFHPDAAELHSVTTDLEKVCRQLHNPSVSL
SDASITLFSAFKPMLASIASVHQIEKQMNNQTFYIETKLDGERIQMHKDGDVYKYFSRNG
YDYTQQFGTSPLEGSLTPFIHKAFKNIQNCILDGEMMAYSPTTQTFMQKGSKFDIKRMVD
DSELQTCFCVFDVLMISDQKLGHEMLSKRYDILNTIFTPIPGRIQIVSRIQANTQKEVVD
ALNEAIDNREEGIVIKDPMSVYKPDKRGEGWLKIKPEYVSGLMDELDLLIIGGYWGKGLR
GGMISHFLCAVAETPSPGGKPSKFHSICRVGSGCTMKELYDLGLKLATYWKKYDRKVPPC
NILCSVEKPQVFIEPCNSVIVQIKAAEIVSSDMYKTECTLRFPRIERIREDKEWYECMTL
DLLEQLRSKASGKLATKHLDIGEDEPQEKKRKTVPKVKKIIGLMDRFKAPDLSKINKVSS
IFEDVEFCIMTGTQNHSKYVLESKVAEYGGSIVQNPGPDTYCVVAGTENVRVKNIISSNN
YDVVRAEWLLQCFQTEKFVPWQPAFMIHMSPETKQHFACEYDTYGDSFTADTDTLQLREV
FSRINTFEKISQHVIADIEARYSWESSLSMFRQQTIYLSLSDEMSNSRNRISQTRFLTVE
LILRFHGAKVVSQLEEGVSHVISGDHSDLKKIKAIRRTFKKKFKIVSERWVKDSIKAGEL
QNENLYIM
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggcttccatccctacttcacattcatcttccaagctaactgtagcatcacaagtccct
tttgcagatctctgttcaacactagaacgaatacagaagtgcaaatcccggtcagataaa
acaagatatttcaaggattttctagattcctggaggaaatttcatgatgctcttcataaa
aatgaaaaggatgtgatagattctttttatcctgcaatgaggcttattcttccacagttg
gaaagagagaggatggcctatggaattaaagaaactatgcttgctaagttctatattgaa
ttgctaaatttacccaaagatggaaaagacgctttaaaacttttaaattttcgaacaccc
actggctcacaaggaaatgctggagactttgctatggttgcctactttgttttgaaatca
agatgcatcagccaaggtcagttgaccatacaacaagtaaatgatcttctagattctatt
tctaataataatgccgccaaaaggaaggatctggttaagaagagccttcttcagttaata
actcagagctcagcactagaacagaagtggttgatcaggatgatcataaaggatttgaaa
cttggtgtcagccagcaaactttattttctattttccaccctgatgctgcagaattgcat
agtgtcacaactgatttggaaaaggtttgtagacagttgcataatccttctgtatcactt
agtgatgcttctattacattgttttctgcctttaaaccaatgcttgcttctattgccagt
gtgcaccagattgaaaagcaaatgaataatcagactttctacatagaaaccaaattagat
ggtgaacgaatacagatgcacaaagatggagatgtttacaaatacttttcccgaaatgga
tatgattatactcagcagtttggtacttctccccttgaaggttcattgactccttttatt
cataaggcttttaaaaatattcaaaactgcattctggatggtgaaatgatggcctatagc
cctaccacacagacttttatgcagaaaggaagcaagtttgacatcaaaaggatggtggat
gattctgaattacaaacttgtttttgtgtatttgatgttcttatgatcagtgaccaaaag
ttgggtcatgagatgctgagcaaaagatacgatatattaaatacaatatttacaccaata
cctggtcgaatacagattgtttctagaattcaagcaaacacacagaaagaagtagtagat
gccctaaatgaagcaattgataacagagaagaaggaattgtaataaaagaccccatgtca
gtttacaagccagacaagcgtggggaaggatggctaaagatcaaaccagaatatgtcagt
gggttgatggatgaactcgaccttttaattattgggggctactggggcaaaggtcttcgt
ggtggcatgatatctcattttttatgtgcagttgctgagactccttcacctggtggaaaa
ccatctaaattccattcgatttgtcgtgttggttccggttgcactatgaaagaactgtat
gatcttggcttgaaattagccacatattggaaaaaatatgacaggaaagttccgccttgt
aatatcttatgtagtgttgagaagcctcaagtctttattgaaccttgtaattcagtgatt
gtccagattaaagctgctgagattgtgagtagtgatatgtataaaacagaatgcacatta
cgttttcctcgcattgagagaataagggaagataaagaatggtatgaatgtatgactctt
gaccttctagaacaactcagaagtaaagcttctgggaagcttgcaacaaaacaccttgat
ataggtgaggatgaaccacaagaaaagaagcgtaaaactgtgccaaaggttaaaaagata
attggcttaatggatcgttttaaagcacctgatctttctaaaataaacaaagtttctagt
atatttgaagatgttgagttttgtattatgactgggacacaaaatcattcaaaatatgtc
ctggaaagcaaagtagcagaatatggtggcagcatagttcaaaatcctgggccagacact
tactgtgttgtggcagggactgagaatgttagagtgaaaaatattatttcttctaataac
tatgatgttgtgagagcggaatggcttttacagtgcttccaaactgaaaagtttgtgccg
tggcagcctgcttttatgattcacatgtctcctgaaacaaagcaacattttgcttgtgaa
tatgacacttacggtgacagtttcacagctgatactgatacgctacagttgagggaagtg
ttctcaagaattaatacctttgaaaagatttctcagcatgtgattgctgacatagaagct
cgttattcttgggagagttctctaagtatgttcaggcaacaaaccatttacctgagcctt
tctgatgaaatgagcaattcaaggaataggataagtcaaaccagatttttaactgtagag
ttgatacttcgctttcatggagcaaaagtagtgtcgcagcttgaagaaggtgtatcccat
gtaatcagtggagatcattctgatttgaagaaaataaaagccatcagaaggacatttaag
aaaaagtttaaaattgtgtctgagcgatgggtaaaggattctataaaggctggagagtta
caaaatgaaaacttgtacataatgtaa

DBGET integrated database retrieval system