KEGG   Python bivittatus (Burmese python): 103050942
Entry
103050942         CDS       T03091                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04010  MAPK signaling pathway
pbi04137  Mitophagy - animal
pbi04210  Apoptosis
pbi04218  Cellular senescence
pbi04620  Toll-like receptor signaling pathway
pbi04621  NOD-like receptor signaling pathway
pbi04622  RIG-I-like receptor signaling pathway
pbi04623  Cytosolic DNA-sensing pathway
pbi04625  C-type lectin receptor signaling pathway
pbi04920  Adipocytokine signaling pathway
pbi05132  Salmonella infection
pbi05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103050942 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103050942 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    103050942 (RELA)
   04218 Cellular senescence
    103050942 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103050942 (RELA)
   04621 NOD-like receptor signaling pathway
    103050942 (RELA)
   04622 RIG-I-like receptor signaling pathway
    103050942 (RELA)
   04623 Cytosolic DNA-sensing pathway
    103050942 (RELA)
   04625 C-type lectin receptor signaling pathway
    103050942 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103050942 (RELA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103050942 (RELA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103050942 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pbi03000]
    103050942 (RELA)
Transcription factors [BR:pbi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    103050942 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 103050942
NCBI-ProteinID: XP_015744179
LinkDB
Position
Unknown
AA seq 511 aa
MRFRYQCEGRLAGSIPGERSTDTTKTHPTIKIHNYQGPGKVRISLVTKEAPHRPHPHDLV
GKDCKEGYYEAELSPERSIHSFQNLGIQCVRKRDLDKAVAKRIETGNNPYNVPMEELKGD
YDLNAVRLCFQVWIRDTGTGHLIQLPLVVSQPIYDNRAPNTAELKICRVNRNSGTCLGGD
EIFLLCDKVQKEDIEVRFFKDSWEAKGSFSQADVHRQVAIVFKTPPYVDQGLREPVTVQM
QLRRPSDKEVSGSMEFRYLPDEGDFHRIEEKRKRTLGTFKNFVQKTPFAVGASEAQAPRR
IAVPKHGVVRPNTSAVPGLLGASGQASLLSAQKPQAMTQPPAGFFVGPGHPTPPPPVAVT
SSFSTVNMEELSCLGVSSQVQPSTLDTETTIADAFLHLHFEGGDALGGILDDAPYSSLDS
INTTEFRQLLNEGAGPSALPDNQGTLLTYPESITRLVSQRRAGGEPGGNGDSGGGGSSTN
NSFLNGLLGALPAEDSFSSMVDLDLNSLLNS
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgcgcttccgctaccagtgcgagggccgcttggccggctccatccccggggagcgcagc
accgacaccaccaagacccaccccaccatcaagattcacaactaccagggtcctgggaag
gtccgcatctctctggtgaccaaggaggccccccaccggcctcacccccacgacctggtg
gggaaggattgcaaagaaggctactacgaggccgagttgtctccggaacgctccattcac
agcttccagaacctgggcatccagtgcgtgcggaaacgggatttggacaaggccgtggcc
aagcggattgagaccgggaacaacccgtacaatgtgccaatggaggaattaaaaggagat
tacgacctgaatgcagttcggctctgtttccaggtctggattcgggatacaggcacgggg
cacttgatccagctgcctctggtggtctcccaaccgatctacgacaatcgcgcccccaat
acagccgaactgaagatctgccgcgtgaaccgcaattcgggaacctgcctggggggggac
gaaatcttccttctctgtgacaaagtgcagaaagaggacattgaagtccgcttcttcaag
gattcctgggaagccaaaggttccttctcgcaggccgacgtccaccgccaggtggccatt
gtcttcaagaccccaccgtacgtggatcagggcctccgcgagcccgtgacggtccagatg
cagctgcgccgtccctccgacaaggaggtcagcggctccatggagttccgttacctcccc
gatgaaggcgacttccatcgaatcgaggagaagcgcaaacggactcttgggactttcaag
aactttgtacagaaaacaccttttgcagtaggagcgtcggaagcgcaagctccacgccgc
attgctgttccgaaacatggggtagtacggcctaataccagcgctgtaccaggtcttctg
ggagcatcggggcaggcgtcactgctgtcggcccagaagccccaggccatgactcaacct
cccgccggcttctttgtcgggcccgggcatcccaccccaccgcctccagtggctgtgacc
tccagcttcagcacagtgaacatggaggagttatcgtgcctgggtgtctcctcacaagtc
cagccctccaccttggacacagaaaccaccatcgcggacgccttcctgcacctgcacttc
gaaggcggggatgcattagggggcatcttggacgacgcgccctacagcagcctggacagc
atcaacaccaccgagttccggcagcttctcaacgaaggagcggggccctcggcgctgccg
gacaaccaggggactctgctgacctacccggaatccatcacccgcttggtcagccagcgg
agggcaggaggggagcctggaggcaacggggacagcgggggcggcggcagttcaaccaac
aacagcttcctcaatggccttttgggggcccttcccgccgaggacagcttttcgtccatg
gtcgatctggacttaaactcgcttctcaactcgtaa

DBGET integrated database retrieval system