KEGG   Python bivittatus (Burmese python): 103051066
Entry
103051066         CDS       T03091                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00220  Arginine biosynthesis
pbi00330  Arginine and proline metabolism
pbi01100  Metabolic pathways
pbi04020  Calcium signaling pathway
pbi04146  Peroxisome
pbi04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    103051066 (NOS2)
   00330 Arginine and proline metabolism
    103051066 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103051066 (NOS2)
   04020 Calcium signaling pathway
    103051066 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103051066 (NOS2)
Enzymes [BR:pbi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     103051066 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 103051066
NCBI-ProteinID: XP_025031386
LinkDB
Position
Unknown
AA seq 1135 aa
MDLNNNMEEASENVHSVAKQDGALVKSLSRKPNGITLLEKAKEKLLQNNTIQTSRCPRHL
KIKNWETGTLLQDALHHQAKEVLNCQTKVCQGSLMNPKGLVRGPRDEPIPRDKLLLQATE
FIHLFYNTLQEAETEQHTARLEAVAREIERTGTYQLTKEELVFATKQAWRNAPRCIGRIQ
WSNLQVFDARSCTSAKEMFEHLCRHLEYSTNGGNIRSAITVFPHRTDGKHDFRIWNSQLI
QYAGYQMPDGSIVGDPANVEFTQLCIQLGWKAKYGCFDVIPLVLQAGGQDPELFELPPEL
ILEVSMEHPTYEWFKDLDLKWYAVPAVSNMLLEVGGLEFTACPFNGWYMGTEIGGRDFCD
ARRYNILQEVGRRMGLETNKLSSLWKDKAVIEVNIAVLHSFQKQNITIMDHHSAAESFMK
YMQNEYRIRGGCPADWVWLVPPISGSITPLFHQEMLNYILSPFYYYQVDAWKTHIWKDEK
RKPKKREIKFCIWAKAVFFASSLMRRVMAARIKVTVLYATETGKSETLARKLGDMFNCAF
NTKVTCMVDYNLRDLEKETLLLVVTSTFGNGDAPSNGKTLQNALLSMKQLSNKFRYAVFG
LGSSMYPEFCAFARTVHQKLAQLGASPVSPMGEGDELNGQEEAFRAWAILTFQTACEIFD
IRGKHRIQLPKEYTCKETWNPKDFRIVYVSQPLELEKALGDIHGKNIVPLTLKCRQNLQS
SQSSRVTMLIKLSCGINQEINYLPGDHLGIFPGNQKALVDGIITHVADAPPFNEIIRLEV
RSDRGYWAPYKKFPACTLSQALMHFLDVTSPPSQQLLRSLSQLAKDESEKERLNLLCHNL
EEYNKWKFYNSPTILEVLEEFPSIRISTSFILSQLPLLKPRYYSISSSQDWEPQELHLTV
AVVTYRSRNGKGPVHHGVCSTWLNTIALNKTIPCFIRSAGGFRLPKDPRKPCILIGPGTG
IAPFRSFWQQRLFDLENKGIPGRGLILLFGCRHSSLDHLYREEMEEMHRKGILQEVYTAY
SREPGSPKVYVQDLLRNELEAEVYRLLHKEEGHLYVCGDVRMASEVAKTLKEMFAKKLSL
AEEEAEDYCFQLKRQKRYQEDIFGATFPKENQRDVEEIKTERDLNVLESQAQLKL
NT seq 3408 nt   +upstreamnt  +downstreamnt
atggatctcaacaataatatggaagaagcaagcgaaaatgtccacagtgtggcaaagcag
gatggtgctctggttaagagtctgagcaggaaacctaatggcatcacactccttgagaag
gcaaaagaaaaacttctccaaaataataccatacaaacatctagatgcccaaggcattta
aaaattaaaaactgggagactggaacactccttcaagatgcattgcaccatcaggccaaa
gaggttcttaactgtcagaccaaagtttgccagggatctctcatgaatccaaaagggtta
gtccgaggtccccgagatgaacccatccccagagacaaattactactccaggcaactgag
tttatccatcttttctacaacacccttcaagaggcagaaacagaacagcacacagcacgg
ttggaagcagtggctcgtgagatagaaagaacagggacatatcaactcaccaaagaagag
cttgtctttgcaacaaagcaggcctggagaaatgctcctcgatgtattgggagaatccag
tggtccaatttacaggtgttcgatgcccgtagttgcaccagtgctaaagaaatgtttgaa
cacctttgtcgccatttggagtattctacgaatggagggaacataaggtccgccatcacg
gtcttcccccacaggactgatggaaagcatgactttcgaatatggaacagccaactcatc
cagtatgccggctaccagatgccagatggatccattgtgggagatccagccaatgtggag
tttacacaactctgcatccagcttggctggaaagccaaatatggctgctttgatgtgatt
ccactggtcctccaagccggaggtcaagacccggaattatttgaattgccgccagagctc
atcctggaggtgtcgatggagcatcccacatacgaatggtttaaagacctagatttgaag
tggtatgcagttccggctgtgtctaacatgctccttgaagttggtgggctggaatttaca
gcttgtccttttaatggctggtacatggggactgagattgggggacgggacttctgtgat
gcacggcgctacaatattcttcaggaagtggggagaaggatggggctggaaacaaataaa
ctctcttcactgtggaaagacaaagctgttatagaggttaatattgctgtgctccatagc
tttcagaaacaaaacatcactatcatggaccaccactctgctgctgaatccttcatgaag
tacatgcagaatgaatatcggattcgtgggggatgtccggcagattgggtttggctggtt
cctcccatctcgggtagcattacacctctcttccaccaggagatgttgaattacatcctt
tcgcctttctattactatcaggtggatgcatggaaaacacacatctggaaagatgagaaa
cgcaagccaaagaaaagagagatcaaattctgcatttgggccaaggctgtgttttttgca
tcctcattgatgcgaagagtcatggctgccaggatcaaagtaacagtgctctatgcaaca
gaaacggggaaatcagagactctagctcgaaagctgggtgacatgttcaactgtgccttc
aataccaaggttacttgtatggttgattacaacctaagagaccttgaaaaggaaactcta
cttctggtggtcaccagtacttttggaaatggcgatgcaccaagcaatggcaaaacactg
cagaatgccctcttgtctatgaaacaattgagtaacaaattccggtatgcggtttttggc
ttgggttcaagcatgtatccagaattctgtgcctttgcccgcactgtgcaccagaaactc
gcacagttgggggcatctccagtcagcccaatgggtgaaggagatgaactcaatggccag
gaagaagcttttcgggcctgggccattcttacattccagacggcctgtgaaatttttgat
atccgcggaaagcacaggatccagttaccaaaagaatatacatgtaaggaaacctggaac
cccaaagattttaggattgtatatgtctctcagccattggagttagagaaagcgcttggc
gatattcatgggaaaaatatagttccattgaccctcaaatgtcggcagaatcttcaaagt
tcacagtccagccgtgttaccatgctaattaaactttcctgtggaatcaatcaggaaatc
aactatctccctggggaccatcttgggatcttccctggaaaccaaaaagctttggttgat
ggcatcatcactcacgttgcagatgctcctccattcaatgagatcatcagactggaagtg
cgcagcgatcgtggttactgggctccttacaaaaagtttccagcatgtacgctctcccaa
gccttgatgcatttccttgatgtcacctctcccccttcccaacagttgctcagatcactt
tcccaactggcaaaagatgaaagtgagaaggagaggctgaatctcctgtgtcataatttg
gaggagtacaacaagtggaaattttacaacagccccactatcttggaagtcctggaggaa
ttcccatccatcaggatctcaacgtctttcatactctcccaactgcctttactcaagccc
agatactactccatcagttcctcacaggattgggagccccaggaattacatctgactgtg
gcagtggtgacctatagatccagaaatggaaaaggtccagtgcaccatggggtatgcagt
acttggttgaataccatcgccttaaataagacaattccctgtttcattcgcagtgccggt
ggattccgacttccaaaagatccgagaaaaccgtgtatcctgattggtcctggcacagga
attgctccttttagaagcttctggcaacagcgactctttgacttagaaaataaagggatc
ccagggaggggtctgatcctgctgtttggctgccggcactccagcctggatcacctctat
cgagaagaaatggaggagatgcatcggaaagggattctccaagaggtctacacagcttac
tccagagaacctgggagtcccaaagtttatgtgcaggatctccttcggaatgaattagaa
gcagaagtatacaggcttctccacaaagaagagggccacctatatgtctgtggggatgtc
cgcatggccagtgaagtggctaagactttaaaggagatgtttgcaaagaagctgagcttg
gcagaagaggaagcagaggattactgctttcagctgaagaggcagaaacgataccaagaa
gacatatttggagcaacgtttccaaaggagaaccaaagagacgtggaagaaatcaaaact
gaaagggacctaaatgtcttggaatctcaagcccagctaaaactttag

DBGET integrated database retrieval system