KEGG   Python bivittatus (Burmese python): 103051221Help
Entry
103051221         CDS       T03091                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
pbi  Python bivittatus (Burmese python)
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pbi01002]
    103051221 (TMPRSS9)
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     103051221 (TMPRSS9)
Peptidases [BR:pbi01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103051221 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Ldl_recept_a Trypsin_2 DUF1639
Motif
Other DBs
NCBI-GeneID: 103051221
NCBI-ProteinID: XP_025031742
LinkDB All DBs
Position
Unknown
AA seq 824 aa AA seqDB search
MRSRSILLGGAPMGLLVITSKPVLDRQTARPVAGGGVCSKAVSAAVLMSTTTALCVGILV
YFLGEQEAHFEHLVELRGIPYQSSLQQPSSGYSCLLTPILEQLFKSSFQNSPLDGCCSRC
TVLQYRKGNASIIVRFHLCFSTQPLSPDIEEDVLRRGLAAAVGTDGVRVPAYGTISAASL
LAGPWDLASSGTALRSGRCPAEVFPCRNGQCAAKGNVQCDGRQDCRDGSDEAECDCGARP
AMRAATRIVGGSEALLGEFPWQVSLRESEEHFCGAAILAATWLVSAAHCFNEFQDPDTWT
AQAGSVRLSGSGGHPATARVLRIFQHPSYNAESADYDAALLELAEPLAFGKYVQPVCLPA
ASHRFSPGRKCLISGWGYLKEDFSSQPENLHRASVGIIEQKICSTLYNFSLSDRMICAGF
LEGKVDSCQGDSGGPLACEETPGTFYLAGLVSWGAGCAQAKRPGVYARITKLKSWILDVV
SPCLSTTTPLRSRTASSSIAPTSSLPPLEQRATWLSPSTSAISLTTPGLAVSTPKATQPP
AVPCTPSTFKCSSKVCIGKVNPECDGVVDCANGWDETNCNCGLTPAAALSKIVGGSGAAR
GEWPWQASLWLRRRQHACGAIVIAERWLLSAAHCFDVYSNPKMWVAVLGTPFLSSLDGQA
EKIAQIHRHPFYNGYMLDYDVALLELASPLRYTNTIKPICLPDRTHVFSEGRRCTITGWG
STKEGGPTATRLQKAAVQVIGEQDCRRFYPAQISSRMLCAGFPRGAIDSCSGDAGGPLAC
KEPSGRWFLAGITSWGYGCARPHFPGVYAKVTAVRGWIGQNLRA
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccagatccatcttgcttggtggggcacccatggggctcctggtcatcacctca
aagccggtgctggacagacagacagcgcggcctgtggctggcggtggggtctgcagcaag
gctgtctcagccgctgtcctcatgagcaccacgacagccctgtgtgtggggatcctagtg
tatttcctgggggaacaagaagcccactttgagcacctggtagagctgcgagggatcccc
taccagagcagtttgcagcagcccagctctggctactcctgcctgctgacccctattctg
gagcagctgttcaaaagcagctttcagaattcacccctggacggctgctgctccaggtgc
accgtcttgcaatacaggaagggcaatgccagcatcattgtgcgcttccacctctgcttc
tccacacagccactcagccctgacatagaagaggacgtgctgaggcggggattggcagct
gctgtgggcaccgacggtgtcagggttcctgcctacggcaccatctcagccgcctccctc
ctggcagggccgtgggacctcgcctcctcgggcacggcactcaggtcaggaaggtgtccc
gcggaggtctttccctgccgcaacggccagtgtgcagccaaaggaaacgtgcagtgcgac
ggccggcaggactgcagggatggctctgacgaggctgagtgcgattgcggggcccggcca
gccatgcgggcagccacgcggatcgtcgggggatcggaggccctgctgggcgagttcccc
tggcaggtcagcctgagagagagcgaggaacacttctgcggggcggccatcctggcagcc
acctggctggtgtctgcagcccactgcttcaacgagtttcaggacccggacacctggacc
gcccaggcaggcagcgtccggctgagcggcagcgggggccacccggcaacggccagggtc
ctgcgcatcttccagcacccctcctacaacgcggagagcgccgactacgacgcggctctg
ctagagctggccgagcccttggccttcggcaaatacgtccagccggtgtgcctgccagcc
gcctcccaccgcttctcccctggcaggaagtgcctcatctccggatgggggtacctgaag
gaagacttctcctctcagcccgagaacctgcaccgggcctccgtggggatcatcgagcag
aagatctgcagcacgctctacaacttctccctctccgaccggatgatctgcgctgggttc
ctggaggggaaggtggactcctgccagggggattcgggggggccactggcctgcgaggag
accccgggcaccttctacttggccgggctggtgagctggggtgctggctgcgcacaggcc
aagaggcctggcgtctacgcccggatcaccaagctcaagagctggatcctagacgtcgtt
tcgccctgtctcagcacgacgacaccgctcagatccaggaccgcctccagctccattgcc
cctacctccagcttgcctcccctggagcaaagggccacgtggctcagccctagcaccagt
gccatcagcttgaccacacccgggctggcagtcagcacccccaaggccacccagccgcca
gctgtgccatgcactccctccacgttcaaatgctccagcaaagtctgcattgggaaagtg
aatccggagtgtgacggcgttgtcgactgtgccaatggctgggacgagaccaactgcaac
tgtggcttaaccccagctgcagccttgagcaagatcgtggggggcagtggtgcagcccgg
ggggagtggccgtggcaggcgagcctgtggctgcggcggagacagcacgcttgcggggcc
atcgtgattgccgagcggtggctgctttcggccgctcactgcttcgacgtttacagcaac
cccaagatgtgggtggctgtcctggggacacccttcctgagtagcctcgacgggcaagcg
gagaagattgcccaaatccacagacacccgttctacaacggctacatgctggactacgac
gtggccctgctggagctggcctctcccctgcgctacaccaacaccattaagcccatctgc
ctcccagaccgcacccatgtcttcagcgagggcaggcgctgcaccatcaccggctggggc
tccaccaaggaggggggccccacggccacacgtttgcaaaaggctgccgtccaggtgatc
ggagaacaagactgcaggaggttctaccctgcccagatcagcagcagaatgctttgtgcg
ggcttcccgcggggggccatcgacagctgctcaggcgacgctggtggccccttggcctgc
aaagagccttctggccgctggttcctggcgggcatcaccagctggggctacggctgcgca
cggcctcacttccccggggtgtatgccaaggttacggcagtccggggctggattggacag
aacctcagggcgtaa

DBGET integrated database retrieval system