KEGG   Python bivittatus (Burmese python): 103051289Help
Entry
103051289         CDS       T03091                                 

Gene name
KMT2D
Definition
(RefSeq) histone-lysine N-methyltransferase 2D isoform X1
  KO
K09187  [histone H3]-lysine4 N-trimethyltransferase MLL2 [EC:2.1.1.354]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00310  Lysine degradation
pbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103051289 (KMT2D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pbi03000]
    103051289 (KMT2D)
   03036 Chromosome and associated proteins [BR:pbi03036]
    103051289 (KMT2D)
Enzymes [BR:pbi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     103051289 (KMT2D)
Transcription factors [BR:pbi03000]
 Eukaryotic type
  Zinc finger
   Cys4 Trithorax
    103051289 (KMT2D)
Chromosome and associated proteins [BR:pbi03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103051289 (KMT2D)
   HMT complexes
    MLL-HCF complex
     103051289 (KMT2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHD zf-HC5HC2H zf-HC5HC2H_2 HMG_box PHD_2
Motif
Other DBs
NCBI-GeneID: 103051289
NCBI-ProteinID: XP_007437348
LinkDB All DBs
Position
Unknown
AA seq 3029 aa AA seqDB search
MDDQKPPREDKCSGTPAADGIVSSEEQGNVEADPLKPPEEGLVREALDTADVKEELLQTC
SLPPKRCAFCNCSKWSLHGQRELLRFDPAPGWTADLSDLPEGKQPGSAEAGNDDLTLIGF
ADSVSAQEVFEPTGHFWAHHWCVVWSAGVVRAEGSWLSLVNKAVISGIAQKCEHCNRQGA
TIPCHAEGCQRHYHFPCAAASGCFQSMKSLKLLCPEHLDQAVQMEDSRCMVCDAPGELRD
LLFCTSCGLHYHGTCLEITVTPRKRSGWQCHECKVCQTCRLSGEDSRMLVCEACEKCYHT
YCLKPAIESLPTDFWKCKSCRVCSDCGFRPSSLESSIQWYENYSLCEGCREQRCNKVNST
EAVQHRQEHIPPASSIPTTDKVASPQPLEEVGVTSREQPEGNVSPVNMQQEEQVPLETGQ
QPLGADRPLELCSEDLEATVGQEQMEVETALEPEKAPSPPPPPPVPPDPVFSAHPEESPL
GAKEHPAFELLPTEPEPTESHIAPAPLAQETESSPRSPLLGVLQDGSSETVEEGEPSEEP
MDTEVEVPGLDSPDRNRIQPNQEEEEEEEEEDEVEVEVATATKMEHEQRFSPQLSEEEAL
DEGHVTVGSEPSEIHLNFANESKCSPSPVEVELLGRTSLPVEAYGSAIPLEGGAVGEEEL
GPAPPSPRPHHLVKSDIVNEISNLSQGDASASSFPGSELPFASPYHEGGGSLSLEMAGLT
STDISLQREDGASLPLGEMDDSLLYDVKGECEKGRRRSSPARSRVKQGRSSSFPGRRRPR
GGSHTGRGRGRSRLKSTTSSIETLALADIDSSPSKEEEEDDDDTMQNTVVLFSNTDKFVL
MQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRCVECIVCEVCGK
ASDPSRLLLCDDCDISYHTYCLDPPLNTVPKGGWKCKWCVCCVQCGAVSPGFHCEWQSNY
THCAPCASLVTCPICHVKYVEDDLLIQCQHCERWMHAVCDNLFSEEEVEQAADEGFDCTS
CQPYVVKPVVPVPPPEIIPVKIKEPEPQYFRFEGVWLTEAGMAVLRNLSLSPLHKRRPRK
TTPATPTMPRPGMLNGEGGLDCLGPLGTDEKRGGDVEADEILKAEVSVEHMECEIKLEAP
PTPDRETTAEADIGKGLLEDSEEVKKRKRKPYRPGIGGFMVRQRKSHTRLKKGSVLLAEV
SRELTAAEGQPEEGVQPNPPAENPAETLAEQGVVEADEKKKRRGRKKSKLEDMFPAYLQE
AFFGKALLDLSRQALLAAGGVRGDGTAHPPVGQGAPRPKVDSGMLQKGPEDGKAALVQPK
GDECLSSRETAAPEGNLKAADAKTENTGTEEQMVPKTSPEPTGAENPTTPPGEGVLSSDL
DKIPTEELPKMESKDVQQLFKDVLGSTEREQQLNSVGVDAEARGIRDPNCSQLAQRPFLQ
GSGASLGPLQPAVPMETYSGVCQSPFLDNKERSGFFSPEQCEPESPWASSSAASTPTTPT
TEGESDGLSYNQRSLQRWEKDEELGELSTISPVLYANMNFPSLKQDYPDWSSRCKQIMKL
WRKVPAPDKAPYLQKAKDNRAAHRINKVQKQAESQISKQTKVEVLRRPDRPTLHLRIPSQ
QGVLSGATQPLPPPSSAASASGQPLYINHAAALPSGSGVESPSELFLKLPSSATSAQPPV
PVPLHEPYGMASACPPPDPGFPSPSLVGQSPTVPGGFVSSSSAASGQSPLLPNPRPAPQT
GELQPTPPGTPRHQPSTPDPFLKPRCPSGSLENLSVPGSPQRAALLLSPPPFGEQQKKGL
DVKKEDTGPAISSPSYSSSYSNSPSSAHPSSEMKAPDVFKAPLTPRQSQVEPQSPGLGHR
PPDSHPLAASPPSQADLYRQSPYPDPYAQPPLTPRPQPPPPEACCVLPPRSLPSDPFSRI
PASPQSQSSSQSPLTPRPLSNEAFCQSPVTPRFQSPDPYSRPPSRPQSRDPFAPLHKPPR
AQIPDAGFKPMPVSHNTLAVGSFSVVPPSSESHPKTNQQSQFIRSPGASVFPSAQPQMRF
TFPPNEPVKSSPSQGVNSHFAPGKPQSTSYVSSPGFHQAGSPLGPSKNTPDSYTISPLRP
PSVLPQQPPSQQDGALSFLPRGGMPSSDKREEGTIGPPSRELQELTAGQEGAVSSNTTQT
EMEKQRQRQRLRELLIRQQIQRNNLRQEKESAAAAATSVQSSWNAEAPGPAFEQISRSMT
PYPSAQDKGLLGSLGSTPGGSKLPSGVMVQAPYMQDERLARPPPAATPSAVDINGRPSVT
AAAQPFYARSVFQTPPAQQQMWQQQQQQQQAASMRLPVSSRFLQPPTQDLSRQTLGGLAP
RLPAPGEQFQTSSGPLGAQFIELRHNIPKGVLGSGAGPPFVQQNLQARPRFFLPGNDSTN
QALKASIMPVQAPVLGSQGMQTQKIPISSSLQGSEMSNNHHSHAKAIPQLILPPGNMEVR
HIPARTPSSSVPKDVPLASANIDATPAAGKNQLGLVSRPLACEVPVEPDLDDDFDSHKDL
VEDDDDLANLSLDPDVAKGDDDLDNLDNLETNDPHLDDLLNGDEFDLLAYTDPELDTGDK
KDIFNEHLRLVESANEKAEREDRLKKEPSVGPYLKDAPSAGAGKPGEQKAPLMSRDDVPK
VKEGLGLLQVPCSSSARVSPSPILATFKAQSDMLDSKMASLPADIKPKVEEGCIKPSPCQ
FNTSTAEKPPVKSEGAEKMIATLGVNIKASQNLMSSGGVQLGMAQFHSNSHTSISDKVLY
STQTRPSLIPVSVPNNTNSILEKFELDGGPLSLTSSQQHSPADELDKMESSLVASELPLL
IEDLLEHEKKELQKKQQMSAQMPGGSQHLQSHAVLAHSAPPSQPHDGQLVSPQQQLQLSI
VARPQGMVGNQQLMQQQQQQRLAGPQQNQGLTPHLGVPQNQTHMLTPQHGIQATHSQQNQ
QQVLAQKNMQGVQQQQMMGLKPQQIVMQQQQQQQQQQQLANSFFPDTDLDKFATEDIMDP
IAKAKMVALKGIKKVMAQGSIGVAPGMNR
NT seq 9090 nt NT seq  +upstreamnt  +downstreamnt
atggatgatcagaaaccacctcgtgaggacaaatgctctggtacaccagcagcagatgga
attgtgtcctcagaagagcagggcaatgtggaagctgatcctctgaagccgccagaagag
ggccttgtgagagaagcattggatacagcggatgttaaagaggaactgctccagacctgc
agcctcccacccaaacgctgtgcgttctgtaactgcagcaagtggagcttgcatgggcag
cgagaactgctgcggtttgatcctgcacctggctggacagcagatctttctgatttgcca
gaagggaagcagcctggctctgcagaagctggaaatgatgatctcaccctgattggcttt
gcagacagtgtgtcagcacaggaggtgtttgagccaacagggcacttctgggctcatcat
tggtgtgtggtgtggtcagctggagttgtacgtgcagaagggtcatggctgagccttgtg
aacaaagctgtcatctcagggattgcacagaaatgtgaacactgtaacaggcagggtgct
actattccatgccatgcagaagggtgccagcgccactatcactttccctgtgcagcggct
agtggctgcttccagtccatgaagagtttgaaacttctgtgtccagagcatctcgatcag
gctgtacagatggaggattcacgctgcatggtgtgcgatgctccaggggaacttcgtgat
ctactcttctgcactagctgtggcttgcactatcatggcacctgcttggagatcacagta
acgccacggaaacgctcgggctggcagtgtcatgaatgcaaggtttgccaaacctgcagg
ctgtctggtgaggacagcaggatgttagtgtgcgaagcctgtgaaaaatgctaccacacc
tactgcttgaaacctgctatcgagagcctccccacagacttctggaagtgcaaaagctgc
cgcgtttgttctgactgtggcttccgcccatcctcattggagtccagcatccagtggtac
gagaactactctctgtgtgaaggatgtcgtgagcagcgctgcaacaaagttaacagcaca
gaggctgtgcagcacagacaggagcatattccccccgcaagcagcatccccacaactgac
aaggtggcttccccccaacccctggaagaagttggtgtgaccagtcgggaacaaccagaa
ggtaacgtcagccctgtcaacatgcaacaagaagagcaagtgccgctggagactggccag
cagccccttggtgcagacagacctttagaactgtgcagtgaggatctggaggccactgta
gggcaggagcaaatggaagtggaaacagcattagagcctgaaaaagccccctctccacca
ccccctcccccagtaccaccagatccggtattttctgctcacccagaggagtccccgctt
ggtgccaaagagcatcctgcctttgaattgctgcccacagagccggagcccacagagagt
cacattgcacctgcacccttggcccaggaaacagagtcctctccaaggagtcctctgctt
ggtgtgctccaagatggttcttcagaaactgttgaagaaggagagcccagtgaagagccc
atggacacggaggtggaagtgccaggccttgacagccctgacaggaatagaatccagccc
aaccaagaggaggaggaagaggaggaggaggaggacgaggtagaggtagaggtggcaaca
gcaaccaagatggaacatgaacagagattctccccacagctgagtgaagaggaggcatta
gatgaagggcatgtcacagttggatcagaacccagtgagattcacctcaactttgccaat
gaatctaagtgctctccttccccagtggaggtggaattgctgggcagaacgtctcttcca
gtggaagcctatggatctgccatcccacttgagggaggggctgttggagaggaggaacta
ggaccagcacccccatccccaaggcctcaccacttagtgaaatcggatattgtgaatgag
atctcaaacctgagtcagggtgatgccagtgccagcagttttccaggctcagagctccca
tttgcctccccatatcatgaaggtggaggctcactttccctcgagatggctggcttaact
tccacagacatcagtctgcagagggaagatggagcctctttgcccctgggtgaaatggat
gattccctgctatatgatgtaaaaggcgaatgtgagaagggacgacggcgtagctcccca
gcccgttctcgtgtcaagcagggtcgcagcagcagttttcctgggaggagacggcctcgg
ggagggtctcacacgggccgagggcggggccgatcacgtttgaaatccaccacttcttcc
atcgagacactggcgcttgctgatattgacagctccccaagcaaagaggaggaagaggat
gatgacgacacaatgcaaaacacagtggtgctcttctccaacacagacaaatttgtgcta
atgcaggacatgtgcgtagtgtgtggtagttttggccgtggtgcagagggccatcttctg
gcttgctctcagtgttctcagtgttaccatccttattgtgtaaacagcaagattactaag
gtgatgctgctcaagggttggcgttgtgtggaatgcattgtgtgtgaggtgtgtggcaaa
gcatctgacccctcccgccttctgctctgcgatgattgtgacatcagctaccacacatat
tgcctggatccacctctcaacacagtgcccaagggcggctggaaatgtaaatggtgtgtg
tgctgtgtgcagtgcggagcagtttcacctggcttccactgtgaatggcagagcaattac
acccactgtgctccctgcgccagtcttgtcacttgtcccatctgccatgtgaaatatgtt
gaggatgacctcttaatccagtgtcagcattgtgaacggtggatgcatgctgtatgtgac
aaccttttcagcgaggaagaagtagaacaggcagcggacgagggatttgattgcacctca
tgccagccatatgtagtcaagcctgttgttccagttccccctccagaaattattccagtg
aagatcaaggaaccagagccccagtattttcgctttgaaggtgtttggttaacagaggcg
ggcatggcagtgctacgtaacctgtctttgtcaccactgcacaagcgtcggccgcgcaag
actacaccagcaacaccaacgatgccacggccaggcatgcttaatggtgaaggtggatta
gattgcctcggccctctgggtacagatgaaaaaaggggtggtgatgtggaagcagacgaa
atcctgaaagctgaagttagcgttgaacacatggagtgtgagatcaaattggaagccccc
cctactccggacagagaaactacagctgaggctgatattggaaaaggccttttggaagac
tctgaggaggtcaagaagcggaagcggaagccctatcgcccaggtattggaggtttcatg
gtgcgacagcggaaatcacacacacgcttgaaaaagggttcagtactcttagcagaagtc
tctcgtgagctgacagctgcagaagggcaaccagaagagggagtgcaacctaacccacct
gctgaaaatcctgctgagaccttggctgaacagggagtggttgaggctgatgaaaagaag
aaacggcgggggcggaagaagagcaagctagaagacatgttccctgcctatcttcaggaa
gcattttttggcaaagcactcctagacctgagcagacaggccctgttggctgctggtggt
gtgcgtggagatggaactgcccatcctcctgtcggccagggagctcccagacccaaggtg
gattccggcatgctccaaaaagggcctgaggatgggaaggcagctctggttcagcccaaa
ggagatgaatgccttagcagcagggaaacggcagctcctgaaggcaacttaaaagcagcc
gatgccaagactgagaatactggcacagaagagcagatggtgcccaagacctctccagaa
cctacaggtgccgagaacccaaccacacccccgggggagggggtgctcagctccgacctt
gacaaaatccccactgaagagttaccgaaaatggagagcaaggatgttcagcagctcttt
aaagatgtcctgggttctactgaacgagagcagcagcttaactctgttggggtagacgct
gaggccagaggcattcgtgatccaaactgctcacagcttgcccagaggccttttcttcaa
ggtagtggtgcatcccttgggcccctgcagcctgctgtacccatggagacttactctgga
gtttgccagtccccattccttgataacaaggagaggagtggcttcttcagccctgagcag
tgtgaaccagagagtccttgggccagcagctctgcagcttccacgccaaccacacccacg
acagagggggaaagcgatgggctctcatacaaccagcggagcctgcaacgttgggagaag
gatgaggaactgggagagctttctaccatctcacctgtcctttatgccaacatgaatttc
cccagcctaaagcaggattacccagattggtctagccgttgcaagcagatcatgaagctt
tggcgaaaggtgccagctccagacaaagccccttatttgcaaaaggccaaagataaccgg
gcagcccaccgcattaacaaggtgcagaagcaagctgagagccagatcagcaaacaaacc
aaagtggaggtgctgcgaaggccagaccgccccacccttcatctacgcataccatcccag
cagggggtgctgtctggtgccactcagccattgccacctccttcctctgctgcttcagca
tcggggcagcccctctacatcaatcatgctgcagctctgccaagtgggtcaggcgtcgag
tcgcccagtgagctcttcctcaagcttccctcttctgccaccagtgcccagcccccagtg
ccagtgcctttgcatgagccctatggcatggcctctgcttgccctccaccagatccaggt
tttccttccccctccttggtgggccagagtcctacagtgcctggcggctttgtctcttcc
tcttccgccgcctctggacaatctccactcctaccaaaccctcgtccagccccacagact
ggagagttgcagcccaccccacctggaaccccaaggcatcagccctctacaccggacccc
ttccttaagccccgctgcccaagtggatccctggaaaacttgtctgtgcctggaagccct
cagcgagctgcacttctgctttcccccccaccctttggggagcagcaaaagaaagggttg
gatgtcaagaaggaggacactggtccagcgattagctctcctagttacagctccagctat
agcaactccccttccagtgctcacccctccagtgaaatgaaggcccctgacgtttttaaa
gccccactcaccccacgccagtctcaggtggagccacaaagcccaggcttagggcatcgg
cccccagattctcaccctctggctgcttccccacccagccaggctgatctctataggcag
tcgccttacccagatccctatgcccagcccccactgaccccaaggcctcagcccccacct
ccagaggcctgctgcgttttgccgcctcgctcgctgccttctgaccccttctcacgcata
cctgccagcccacagtctcaatctagctcccagtcccctctcactccccgtccgctctcc
aatgaagccttctgccagtctcctgtcactcctcgctttcagtcccctgacccctactcc
agacctccttcccggccccagtcccgggacccctttgcccccttgcacaagccccctcgg
gctcaaatcccagatgctggcttcaagccaatgcctgtctcccataacaccctggcagtt
gggagtttctcagtagtgccaccctcatctgagtcccacccaaagaccaaccagcaatct
cagtttattcgctcccctggtgccagtgtctttcccagtgctcagccgcagatgcggttc
accttccctcccaatgagccagtcaaaagttctccttcccaaggggtcaacagccatttt
gctcctggcaaacctcaaagcacaagctatgtttcttcaccgggcttccaccaggctggg
agccctctgggcccaagcaaaaacaccccagactcctacacaatctccccgctacgacct
ccatcggtgctgccccagcagccgccttcacagcaagatggcgctttgtccttcctgcca
cgaggaggcatgccctcaagtgacaagagggaggaggggacaataggaccccccagtagg
gagctgcaagaactgacagctggccaggagggggctgtcagcagcaacactacccagacg
gagatggaaaaacagcgccagcgccagaggctccgggagttgcttatacgtcagcagatc
cagaggaacaacttgaggcaagaaaaagagagtgcagcagctgcagccaccagtgttcag
tcctcgtggaatgctgaggcccctgggccagcctttgagcagatcagtcgcagcatgact
ccgtacccatcagcacaggacaagggactacttggtagcttggggagcaccccagggggc
agcaaactccccagtggtgtgatggtacaggcaccctacatgcaggatgaacgactggct
cggccacctccagcagcaacgccgtcagctgtggatatcaatggcaggccatcagtaaca
gcagctgcacagccattttatgcccgcagtgtcttccaaactccacctgcacagcagcag
atgtggcagcagcagcagcagcagcagcaagcagcatccatgcgtctcccagtctcttca
cgcttcctacagccccccacccaagacctaagtcgtcagactttgggaggcctggctccg
cgcctgcctgctcctggggaacagtttcagacttcatctggcccactaggagcccagttc
attgagttaaggcacaacatcccaaaaggagtgctaggaagtggagctggccctccgttt
gtccaacagaatctgcaggctcgacccagattcttcttgcctgggaatgacagtaccaat
caggctttgaaagcttccattatgcctgtgcaggcccctgtcctgggaagccaagggatg
caaacacagaagatccctatttcatcctcccttcagggttcagagatgagcaataatcat
cactctcatgccaaggccattccccagttaatactgcctcctggcaacatggaggtgcga
catatcccagcccgaacaccctcttcatctgtccctaaagatgtaccccttgcctcagcc
aacattgacgctaccccagccgctggcaagaatcagctaggtctagtcagcaggccatta
gcttgcgaggtcccagtggaaccagatttagatgatgattttgattcccacaaggacctt
gttgaagatgatgatgacttggccaacttaagccttgatccagatgttgccaagggtgat
gatgatcttgacaacctggataacctggaaaccaatgacccacaccttgatgatctatta
aatggtgatgagtttgatttgctagcgtatacagacccagaactggacactggagataag
aaggatatcttcaatgagcatctgcggttggtggaatctgccaacgaaaaggctgaacgt
gaggatcggctaaaaaaagagccctctgtaggtccctacctcaaggatgctccctctgct
ggtgctggcaagccaggtgaacagaaggcaccactaatgtccagagatgatgttcccaaa
gtgaaagaaggacttggccttctccaagttccctgttcatcttctgcaagggtgtctcca
tcccccatccttgcaaccttcaaggcccaaagtgacatgctggacagcaagatggctagc
ctgccagctgatatcaaacccaaggtagaggaaggctgtataaagccctcaccctgccag
tttaatactagcactgcagagaaacctcctgtcaaatctgaaggagcagagaaaatgatt
gctaccttaggagtaaacatcaaagccagccagaatctcatgagttctggtggagtgcaa
cttggtatggctcagttccacagcaacagtcacacttccatatcagataaggtcctctac
agcacccaaacccgtccatcacttattcctgtctcagtgcccaacaacactaattccatc
ctggaaaagtttgagctagatggagggcccttgagtctgactagtagtcagcagcactct
ccggctgatgaactagacaaaatggaaagctccttggtggccagcgagctccctctcctg
attgaagatctgctggaacatgaaaagaaggaactgcagaagaagcagcagatgtctgcc
caaatgcccgggggctcccagcacctccaatcccacgctgtattggcacattctgctccc
ccttcccaacctcatgatgggcagctagtaagccctcagcaacagctgcagttgagcatt
gtagccagaccacagggcatggtgggcaaccagcaactgatgcagcagcagcagcagcaa
cgtctggctggtccccagcaaaaccaagggctaacaccacacctgggagtacctcagaac
cagactcacatgcttacccctcagcatggcatacaggcaactcatagccaacagaaccaa
cagcaggtcttagcccagaagaatatgcaaggcgtccagcagcagcagatgatgggactt
aagccccaacaaattgtgatgcagcagcaacaacagcagcagcagcagcagcagctggct
aacagcttcttccctgatacggatctagataaatttgctactgaggacataatggatccc
attgccaaagccaagatggtggctctaaagggtatcaagaaagtcatggcacaaggcagc
attggggttgctccaggcatgaataggtaa

DBGET integrated database retrieval system