KEGG   Python bivittatus (Burmese python): 103051634Help
Entry
103051634         CDS       T03091                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04010  MAPK signaling pathway
pbi04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103051634 (CACNA1E)
   04020 Calcium signaling pathway
    103051634 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pbi04040]
    103051634 (CACNA1E)
Ion channels [BR:pbi04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103051634 (CACNA1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 103051634
NCBI-ProteinID: XP_007422133
LinkDB All DBs
Position
Unknown
AA seq 2289 aa AA seqDB search
MARFGEAMAGRLGSGDGAIEQNRSRQGAPASSGGTPGAYKQTKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFVFHKGSYLRNGWNVMDFIVVLSGILATAGAHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHQACYVNNSGELQELDPPHPCGVQGCPAGYECRDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALEVLRRATIKRNRT
EAMNRDSSDERVDISSVGTPLARSSIKSAKLDGASYFRHKERLLRISVRHMVKSQVFYWL
VLSIVALNTACVAIVHHKQPPWLTHLLNYAEFIFLGLFLLEMSLKMYGMGPRLYFHSSFN
CFDCGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKVTKYWASLRNLVVSLMSSMK
SIISLLFLLFLFIVVFALLGMQLFGGRFNFMDGTPSANFDTFPAAIMTVFQILTGEDWNE
VMYNGIRSQGGVSSGMWSSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEE
AFNQKHALQKAKEVSPMSAPNMPAIERDRRRRHHMSMWEPRTSNLRERRRRHHMSVWEQR
TSQLRRHMQMSSQEGINKEDPPLLNPHASIFRKRKLLENSGLEKNEGDQGGRPEQTNGEG
LEQKLPGSNPCPSIRDDQRSPSPQAKREWEEWHHKSFHGNCDLNDQEGKGSVSFDERARL
RQSQRRSRHRRVRTEPKENRTISQENGPEGVTPAKGEQNGDQKENGEEKETITEKEPVAD
MEQKRSSEATTNNAELPMTTQEPSPSEGHLMLDKSKEASPVKQDASSLETSEQALLGDLP
METGRTISRSEPDLSSITANMDKATESTTIMIDVQDSTVVQISNKTDGEASPLKEAETKE
EEEVEAEKKNKKRKKEKSSETGKPMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLV
IAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLW
NILDFIVVVGALMAFALANALGSNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCV
VTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKDCIGNYIDHEKNTME
VKCREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIF
YVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQ
NRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPYTYELALKYLNIAFTMVFS
LECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDSKPTVTSSFNMSFLKLFRAAR
LIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINR
HNNFRSFLGSLMLLFRSATGEAWQEIMLSCLEGKGCEPDTTATSGQNENERCGTELAYVY
FVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRIWAEYDRAACGRIHYT
EMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDNTVHFTSTLMALIRTALDIKIA
KGGADWQQLDSELQKEILTIWPHLSQKMLDLLVPMPKTTDLTVGKIYAAMMIMDYYKQSK
AKKQRQQLEEQKNAPMFQRMEPSSLPQEIISNAKALPYLQQDTISGLSSRSGFPSLSPLS
PQEIFQLACMDSGHGEYQERQSLEPEIREFKRVQPSNCGSYLPVDTQERAVSGRASSMPR
LTMDPQVVTDPGSMRRSFSTIRDKRTNSSWLDEFSMERSSENTYKSRRRSYHSALHLSSR
RLNTDSGHRSDTHRSGGRERGRSKERRHLLSPDISRCNSEERSPQADIDSPERHHSRSPS
EGRSQTPNRQGTGSLSESSIPSLSDTSTPRRSRRQLPPVPPKPRPLISYTAMMQHCGDTS
PPPDDSEGGSPLLSGTLETNNTCLTESSSSLQGKQSLLSTPQRYISEPYLMLQDDSHASD
CGEEETLTFEAAVATSLGRSNTIASGPRSRHGWQMPNGHYRRRRRGASQSMIYGAGIEVL
SDTEEDDKC
NT seq 6870 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcttcggtgaggcaatggctggcaggctgggatctggagatggagccatcgaa
cagaataggagccgccagggagctcctgcttcttcagggggaaccccaggagcatacaag
caaaccaaagctcaacgggccaggactatggcattgtacaatcccatacctgtccgccag
aactgcttcacggtcaaccgatctctcttcatctttggggaagataacattgtcaggaaa
tatgccaagaagctcatcgactggccgccttttgaatacatgattctggcaaccatcatt
gcgaactgcatcgttctggccctggagcagcatctccccgaagatgataagacacctatg
tctcgcagattagaaaagacagaaccttattttattgggatcttttgctttgaagctggc
attaaaatagttgcattgggattcgttttccacaagggttcatacctgcgaaatggatgg
aatgtcatggatttcattgtggtcctaagtggcatccttgcaacagcaggagcacatttt
aacactcatgtggacctgcggactctgcgggcggtacgagtgctcagacccttgaagctc
gtctcaggcattcctagtttacagattgtactgaagtccatcatgaaggcaatggtacct
ctgctccagattggtctcctcctcttttttgcaatcctgatgtttgccattattggcttg
gaattttatagtggaaagctacaccaggcatgctatgtaaacaattcaggtgaattacaa
gaactggacccaccacatccctgtggggtgcaaggatgccctgcaggttatgagtgcaga
gactggattggtcccaatgatgggatcactcagtttgacaacattctctttgctgtgttg
actgtcttccagtgcattaccatggaaggatggactacagtgctgtacaataccaatgat
gccttaggagccacctggaattggttgtacttcattcccctcatcataattggatcgttt
tttgttctcaaccttgtcctgggagtgctttctggagaatttgccaaggagagagagcga
gtggaaaatcgccgggccttcatgaaactgaggagacagcagcagattgagagggagctg
aatggctaccgggcctggatagacaaagcagaggaagtaatgctggctgaagagaacaaa
aattctggcacatcagccttagaagtacttaggagagcaactattaaaaggaaccggaca
gaagccatgaatcgtgattccagtgatgagcgtgtggatatctcttctgtgggaacccca
cttgctcgatccagcatcaaaagtgcaaaattggatggggcctcatacttccgacacaag
gaacggctcctgcggatctctgtccgtcacatggtgaaatcccaagtgttctattggctt
gtcctgagcattgtggccctcaacaccgcttgtgtggctattgtccatcacaagcagcct
ccatggctcacacacctgctaaattatgcagagtttatatttctggggctgttcctccta
gagatgtccttgaagatgtatggaatggggccacgtctttacttccattcttctttcaac
tgctttgactgcggggttacagtggggagcatctttgaagtggtttgggctatctttaga
cctggaacctctttcggaattagtgtcttgcgagccctacgacttctacggatctttaaa
gtcacaaagtattgggcctccttgaggaatttggtggtctctctgatgagttctatgaag
tctattatcagcctgctcttcctccttttcctcttcattgtagtctttgctctacttggg
atgcaactttttggtggcagatttaattttatggatggcactccttcagcaaattttgac
acctttcctgcagccataatgacagtttttcagatattaacaggtgaagattggaatgag
gtgatgtacaatgggattcgctctcaaggtggtgtcagctcaggaatgtggtcgtccatc
tacttcatagtcctcacattatttggaaactataccctacttaatgtgttcttggccatc
gctgtggacaacctagccaatgcacaggaactgacaaaggatgaacaggaggaagaagag
gctttcaatcagaagcatgctctgcagaaagccaaggaagtcagtccaatgtctgctccc
aacatgcctgctatagaaagagacagaaggaggaggcaccacatgtcgatgtgggaacca
cgcaccagtaatctgagggagaggagaaggagacatcacatgtctgtgtgggaacagcgg
actagccagctccgccgacatatgcagatgtccagccaagagggcatcaacaaggaggat
cctcctctgctcaatccacatgccagtatttttcggaaaagaaagttactggaaaactct
ggcctggaaaagaatgagggtgatcaagggggtaggccagagcagacaaatggagaaggt
ctggagcaaaaactcccagggtccaatccctgccccagcatccgagatgaccagagaagt
ccatctcctcaggccaagagggaatgggaagagtggcatcacaaatcatttcatgggaat
tgtgatctcaatgaccaggaaggcaaaggaagcgtgagctttgatgaaagggctcggctc
cggcaaagtcagaggcgcagccggcaccgcagggtgaggactgaaccgaaggagaataga
acaattagccaagagaatggcccagaaggggtcacaccagcaaaaggagagcagaatggg
gatcagaaggaaaatggagaggagaaggagacaatcaccgaaaaggaaccagtggctgac
atggagcagaaaaggagcagtgaagcaacaacaaataatgctgagcttcccatgaccacc
caagaaccaagcccctccgaaggtcacctgatgttagacaaaagcaaggaggcaagtcca
gtgaagcaggatgccagcagcctagagacaagtgagcaagcacttttgggtgacctacca
atggagacagggaggactatcagcaggagcgaacctgatctttcatctatcactgccaac
atggataaagcaacagagagcactaccatcatgattgatgttcaggactccactgtggta
cagattagcaacaagacagatggagaggccagtccattgaaggaggcagaaacaaaggaa
gaggaggaggtggaggcagagaagaagaataaaaaacggaaaaaggagaagagctctgag
acaggcaaaccaatggtgccacatagctccatgtttattttcagcaccacaaacccaatc
cgaagagcttgccactacattgtcaatctgcgctactttgagatgtgtatccttcttgtg
attgcagcaagcagcatcgccttggcagcagaggatcctgtcctgaccaactcagagaga
aataaagtcctgaggtattttgactatgttttcactggcgtcttcacctttgagatggtt
attaagatgattgatcagggattaatactgcaagatgggtcttattttcgggacctttgg
aacatcctggatttcattgtggtcgttggagcactgatggcctttgccttggcgaatgct
ttggggtccaacaaaggtcgtgacattaaaacaatcaagtcccttcgtgttctacgtgtc
ttgagacctttgaagaccatcaagcgtttgcccaaactcaaggcagtctttgactgtgtt
gtaacttctctgaaaaatgtcttcaacatactcattgtctacaaactcttcatgttcata
tttgctgttatcgcagtccagcttttcaaaggcaaattcttctactgtacagacagttca
aaggatacagagaaagactgtattggaaactatatagaccatgagaaaaacacgatggaa
gtaaaatgtcgagaatggaagcgccatgaattccactatgacaatatcatttgggctttg
cttacactctttactgtttccactggagaaggatggcctcaagttctacaacattcagta
gatgtgactgaggaagaccgtggccccagccgtagcaaccgcatggagatgtccattttt
tatgtggtttactttgtagtcttccctttcttttttgttaacatctttgtggctcttatc
atcatcactttccaggagcaaggagacaaaatgatggaagagtgcagtcttgagaagaat
gagagagcctgcattgactttgctatcagtgccaaacccctcacccgctacatgcctcaa
aaccgacatacctttcagtaccgagtttggcactttgtggtctctccatcatttgaatac
accattatggctatgatagctcttaacactgtggttctaatgatgaagtactattctgct
ccgtacacatatgaattggctctgaagtacctgaatattgcttttaccatggttttctca
ttggaatgtgtcctgaaaatcatagcttttggtttcctgaattatttccgtgacacctgg
aacatatttgatttcattaccgtgattggcagcattacagaaattatcctgacggatagt
aagccgacagttaccagcagcttcaacatgagctttctgaagttatttcgggctgcccgt
cttatcaaactgcttcgccaagggtataccattcgaattctgctctggacctttgtgcag
tcattcaaggctcttccatatgtctgtcttctcattgcgatgctcttcttcatttatgca
atcattgggatgcaggtgtttgggaatatcaagctagatgaagaaagccacattaaccgt
cacaacaatttccgcagcttccttggttcactcatgttactgtttaggagcgctacagga
gaggcatggcaggagattatgctttcatgcctagaagggaaaggttgtgaaccagacact
acagcaacatctggacaaaatgagaatgagagatgtggcacagaactagcgtatgtctac
tttgtctccttcatcttcttttgctccttcttgatgctcaatctctttgtggctgtcatt
atggacaattttgaatacctgactcgagattcctctatcttgggaccccatcatcttgat
gaatttgtccggatttgggcagaatatgatagagctgcatgcggccgcatccattacact
gagatgtatgaaatgctgactctcatgtccccaccactaggcctcgggaagagatgtccc
tccaaagttgcttataagagactggtcctgatgaacatgccagtggctgaggacaacaca
gtgcatttcacttccaccttgatggcattaattagaacagctcttgatattaagattgca
aaaggtggtgcagactggcaacagttagactctgagctccagaaggaaatactgaccatt
tggcctcacctttctcagaagatgctagatctattggtgcccatgccaaaaactacagac
ctgacggttgggaaaatctacgcagccatgatgataatggactactataaacagagcaaa
gctaaaaaacaaagacagcagctggaagaacagaaaaatgccccaatgttccagcgcatg
gagccttcatctcttcctcaggagatcatttccaatgccaaagctttgccttacctccag
caagacacaatttcaggactgagcagccgtagtggattcccctccctgagtccgctctct
ccccaagagatattccagttggcatgtatggattcaggccatggagaataccaagaacgg
caatctctggagccagaaattagagagtttaaaagagtgcagccctctaactgtggcagt
tatctcccggtggatactcaggaacgagctgtatctgggagggcttcttccatgccacgc
ctgactatggatccccaggtagttacagatcctggctccatgagacgctcattttctaca
atccgagacaaacggacaaattcctcctggctagatgagttctcaatggaaaggagcagt
gaaaatacctacaagtctcgtcgtcgcagttaccattctgcgctgcacctgtcttcgcgc
cgcctcaacacggactcaggccatcgatccgatacacatcggtccggaggcagagaacga
ggccgatccaaggaacgaaggcacctactctctccagatatctcccgttgcaactcagag
gaaagaagtccacaagcagacattgattctccagagcgacatcattccaggtcccccagt
gaaggcaggtcacaaactcccaacagacagggcacgggctccttgagtgagagttccatc
ccttctctgtctgacaccagcacaccaaggcgaagccgccgtcaactccctccagtgcca
ccaaagccacgacccctcatctcctacactgctatgatgcagcactgtggtgacacctcc
ccaccgcctgacgatagtgagggagggtcccctctgctttctgggactctggagacaaac
aatacctgcttgactgagtcttccagctccctacagggaaagcagagccttctctccact
ccccagcgctacatctcagagccttacctgatgcttcaggatgactcccatgcttcagac
tgtggtgaggaggagacactcacttttgaggctgctgtggccactagccttggccgctcc
aacacaattgcatcgggccctcgctctaggcatggttggcagatgcccaatgggcattac
cggaggaggagaagaggggcatcacaaagcatgatatatggggctggcatcgaagtacta
agtgatacggaagaagatgacaagtgctag

DBGET integrated database retrieval system