KEGG   Python bivittatus (Burmese python): 103051832Help
Entry
103051832         CDS       T03091                                 

Gene name
PLOD3
Definition
(RefSeq) procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
  KO
K13646  lysyl hydroxylase/galactosyltransferase/glucosyltransferase [EC:1.14.11.4 2.4.1.50 2.4.1.66]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00310  Lysine degradation
pbi00514  Other types of O-glycan biosynthesis
pbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103051832 (PLOD3)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    103051832 (PLOD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pbi01003]
    103051832 (PLOD3)
Enzymes [BR:pbi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.4  procollagen-lysine 5-dioxygenase
     103051832 (PLOD3)
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     103051832 (PLOD3)
    2.4.1.66  procollagen glucosyltransferase
     103051832 (PLOD3)
Glycosyltransferases [BR:pbi01003]
 O-Glycan biosynthesis
  O-linked Gal type
   103051832 (PLOD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Anp1
Motif
Other DBs
NCBI-GeneID: 103051832
NCBI-ProteinID: XP_007435873
LinkDB All DBs
Position
Unknown
AA seq 454 aa AA seqDB search
MELRAIPVLRAAVMLAALVLGASAGSEGERETVDPGKLLVLTAATERTEGYRRFLRTAKY
FNYTVKTLGLGEDWKGGDVARTVGGGQKVRWLKAEMKKYANEEDLIVMFVDSYDVILAGS
PIELLWKFLQLKSNLVFSAESFCWPEWSLAEKYPPVTLGKRFLNSGGFIGYAPVINRIVQ
LWKYKDDDDDQLFYTRIFLDPALREKYGIALDHTSKIFQNLNGAIDEVVLKFEQTRVRAR
NVAYDTLPVVIHGNGPTKLQLNYLGNYIPNAWTYEGGCEVCDDDLLDLSDVPEESYPRVL
LGVFIEKPTPFLPQFLQRLLTLDYPYSHLSLFLHNHEVYHEPHIQAEWDQLRKAFASVKL
IGPEEELSEGEARDMAMDLCRQDSSCDYYFSLDADVVVTNPEILQILMQENKYVIAPMMS
RHGKLWSNFWGALSPDEYYARSEDYVELVQGKRM
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggagctgcgagcgatccccgtcttgcgcgccgccgtgatgctggccgccttggtgctg
ggcgcctccgcgggcagcgaaggcgagcgggaaaccgtggatcctggcaagcttctggtc
ctaactgctgccacggagagaacagagggataccggcgctttctacggactgccaaatat
ttcaactacacggtcaagactttagggcttggtgaagattggaaaggaggggatgttgcc
cggacagtcggcggaggtcagaaagtccgttggctgaaggctgaaatgaagaaatacgca
aacgaagaggatcttattgtcatgtttgtggacagctatgatgtgatcctggctggaagc
ccaattgagcttctttggaagttcctgcagcttaagagcaacctggtcttctcggcggaa
agtttctgctggccggagtggtccctggctgaaaagtaccccccggtgaccttgggcaaa
cgcttcctcaactctggagggttcatcggctatgcccctgtcatcaaccgcattgtccag
ctgtggaagtacaaggatgatgatgatgaccagctgttttacacacgcattttcttggat
cctgccttgcgtgaaaaatacgggatcgccctggatcacacgtccaaaatcttccagaac
ctgaacggggccattgacgaggtagtgctgaaattcgagcagacccgagtgcgtgcccgg
aacgttgcgtatgatacccttcccgtggttatccatggcaatggacctaccaagttacag
ctgaactatttggggaattacatccccaatgcctggacatacgaggggggatgtgaggtg
tgcgatgatgacctcctggacctctcggacgtgccagaagagtcatatccacgtgttctg
ctgggtgtctttattgaaaagcctacaccgttcctgcctcagtttctccagcgtcttctg
actttggattatccttattctcacctcagccttttcctccataaccatgaggtgtatcat
gagccccacatccaagctgagtgggatcaacttcgcaaggcctttgccagcgtcaaactg
atagggccggaggaggaactgagtgagggtgaagcccgagatatggctatggatctgtgc
cgacaggattcttcctgtgactattacttcagccttgatgccgatgtggtggtgacaaac
ccagaaatcctgcaaatacttatgcaggagaacaagtacgtgattgctcccatgatgtct
cgccatggcaagctttggtctaacttttggggcgccctcagcccggatgaatattacgcc
cgctcagaggactatgtggaactggtgcaaggcaagagaatgtaa

DBGET integrated database retrieval system