KEGG   Python bivittatus (Burmese python): 103051894Help
Entry
103051894         CDS       T03091                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00010  Glycolysis / Gluconeogenesis
pbi00053  Ascorbate and aldarate metabolism
pbi00071  Fatty acid degradation
pbi00280  Valine, leucine and isoleucine degradation
pbi00310  Lysine degradation
pbi00330  Arginine and proline metabolism
pbi00340  Histidine metabolism
pbi00380  Tryptophan metabolism
pbi00410  beta-Alanine metabolism
pbi00561  Glycerolipid metabolism
pbi00620  Pyruvate metabolism
pbi01100  Metabolic pathways
Module
pbi_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103051894 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    103051894 (ALDH2)
   00620 Pyruvate metabolism
    103051894 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103051894 (ALDH2)
   00561 Glycerolipid metabolism
    103051894 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103051894 (ALDH2)
   00310 Lysine degradation
    103051894 (ALDH2)
   00330 Arginine and proline metabolism
    103051894 (ALDH2)
   00340 Histidine metabolism
    103051894 (ALDH2)
   00380 Tryptophan metabolism
    103051894 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103051894 (ALDH2)
Enzymes [BR:pbi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103051894 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF4815
Motif
Other DBs
NCBI-GeneID: 103051894
NCBI-ProteinID: XP_007433657
LinkDB All DBs
Position
Unknown
AA seq 526 aa AA seqDB search
MVLQLAAALRSSPRLRPGAAALRLACKPLSTAAVPAPNPQPEITYNKIFIDNEWHDAVSK
KTFSTINPSTGEVICQVAEGDKADVDKAVKAAKDAFKFGSPWRRMDASHRGKLLNRLADL
IERDRTYLAALETLDNGKPYSISYLVDLDMVIKNLRYFAGWADKLHGKTIPIDGDFFTYT
RHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKLAEQTPLSGLYVASLIKEAGFP
PGVVNIIPGFGPTAGAAISSHMDVDKVAFTGSTSVGHQIQKAAAESNMKRVTLELGGKSP
NIIMSDAEMDWAVEQSHSALFFNQGQCCCAGSRTFVQEDIYHEFVERSVERAKSRVVGNP
FDFKTEHGPQVDETQYKKILGYIDSGKKEGAKLLCGGNPAADKGYFVQPTIFGDVQDDMT
IAKEEIFGPVMQILKFKTIEEVIQRANDTKYGLAAAIFTKDIDKANYISQGLRAGTVWIN
CYNVFGAQVPFGGYKESGQGREGGEYGLTPYMEVKTVTIKVPQKNS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgcagctggccgcggccttgcggagctctccccggctgcgccccggggcggct
gcgctccgcctcgcctgcaagcccctgtccaccgccgccgtgcctgcgcccaaccctcag
ccagagatcacctacaacaagattttcattgacaatgaatggcacgatgcagtcagcaag
aaaacattttcaaccatcaacccatccacaggggaggtcatatgccaagttgcagagggc
gacaaggcagatgtggacaaggctgtaaaggcagccaaggatgccttcaaatttgggtct
ccttggaggaggatggatgcctcccaccgaggcaaactactgaaccgtctcgccgacctg
attgaaagagaccggacctatttggcagctctggaaacattggacaatggcaagccatac
tcaatctcctacctggtagacttagatatggttatcaagaacctccggtactttgcaggt
tgggctgacaaattacatggaaaaaccattcccatcgatggagactttttcacttacaca
agacatgagcctgtaggcgtttgtggacagatcattccatggaatttcccattgctgatg
caggcatggaagcttggtcctgccctggccacaggaaatgtggtggtgatgaaactggct
gagcaaactcccttgtctggtttgtacgttgccagcctgatcaaagaggctggattccca
ccaggtgtggtgaacattattcctggttttgggcctacagctggtgctgctatatcttct
cacatggatgtggataaagttgcattcactggttccacctcggttgggcaccagatccag
aaggctgcagcagagagtaatatgaagagagtgactcttgagcttggtgggaagagccca
aacattatcatgtctgatgctgaaatggactgggctgtggaacaatcccattctgcattg
ttcttcaatcaaggacagtgctgctgtgctggatctcggacctttgtccaagaagatata
tatcatgagtttgtggagaggagcgtggagagagccaaatccagagtagttggaaacccg
tttgacttcaaaactgaacatgggcctcaggtggatgaaacacagtataagaagatcctt
ggatacattgacagtggaaaaaaagaaggagcaaaattactttgtggtgggaaccctgca
gcagataagggctactttgtccagccaactatctttggagacgtgcaggatgatatgaca
atagccaaagaagagatttttggacctgttatgcagatcttgaaattcaaaaccattgag
gaagtcatccagagggcaaatgacaccaaatatgggctggcagctgctattttcacaaaa
gatattgacaaagcaaactacatttctcagggcttgcgagctggaactgtttggataaat
tgctacaatgtgtttggggcacaggttccatttggagggtacaaagaatccggccaaggg
cgtgaggggggagaatacggcctgaccccgtacatggaagtaaaaacagtcaccatcaag
gtcccacagaagaattcttga

DBGET integrated database retrieval system