KEGG   Python bivittatus (Burmese python): 103051995Help
Entry
103051995         CDS       T03091                                 

Gene name
KLKB1
Definition
(RefSeq) plasma kallikrein isoform X1
  KO
K01324  plasma kallikrein [EC:3.4.21.34]
Organism
pbi  Python bivittatus (Burmese python)
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pbi01002]
    103051995 (KLKB1)
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.34  plasma kallikrein
     103051995 (KLKB1)
Peptidases [BR:pbi01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103051995 (KLKB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin PAN_1 PAN_4 DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 103051995
NCBI-ProteinID: XP_015745547
LinkDB All DBs
Position
Unknown
AA seq 642 aa AA seqDB search
MEKSYSQYSFCSRMFWISQALYFTVLFSSARSECMSKIYRNTYIQGGDISKVYTPTADYC
QMVCTYHPRCLLFSYIPGNWAKNTARFSCFLKEIDTQELPKVPQEGIISGHSLKQCTQIT
ACSKKVYEGLDMQGENYNITTADNYHRCQQRCTNDKHCYFFTYTLESFHSPALRNKCYLK
YSSTGTPTQIRQLRDVVSGFSLKPCQLAQTDCQMDFFQHFAFSGITVAKVLTPDKFVCRT
VCTYRPNCLFFTFFSSEWEIKSQRYTCLMMTSRSETPDRIAERANAISGFSLLNCQRAEP
ACHSQTYPELNFHGTELSVEYVDGHKACQELCTMTLRCQFFIYVFRKMQCNHEGKCKCYL
RMSANGSPDNIEAKNEIVSGYSLRLCQTSRSPVCVQKPKQQSRIVGGSNSSVGEWPWQVS
LHTKLSIQSHHCGGSIISDQWILTAAHCLEDIPLTEHWHVYSNILKQSEITNETTFFKVQ
KMIIHPRYEISEAGYDIALLKLDTPMNFSVLQQPVCLPSQEEMNMAKYTECWVTGWGYTK
ERGTIEDTLQKVKIPIMPNAECQFQYPEHRITDKMLCAGYPEGGKDACQGDSGGPMSCKF
QNSWYLVGITSWGEGCARPGQPGVYTNVAKFVDWILEQTLED
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaagttacagccagtacagcttctgctccaggatgttttggatttctcaagca
ctttatttcactgtgttgttttcttctgcacgtagtgaatgtatgtccaagatctacaga
aacacatatatccaaggaggagacatatctaaggtttatactccaactgcagactattgt
cagatggtgtgcacttatcacccaagatgtcttttgttctcctacatacctggaaactgg
gcgaaaaatactgcaaggttttcttgcttcctgaaagaaattgatactcaagaattgcca
aaagtaccccaggaaggaataatctctggtcattctctgaagcaatgcactcaaattact
gcttgcagcaaaaaagtatacgaaggactggatatgcaaggagaaaattacaatataact
actgctgacaattatcatcgctgccaacagagatgcaccaacgataagcactgttacttt
ttcacgtataccttagaatcatttcacagcccagctctgcgtaataaatgctacttgaaa
tatagtagcacaggaaccccgacccagataaggcagcttagggatgttgtctctggattc
tcattgaaaccatgccaacttgcccaaacagattgtcagatggactttttccaacatttt
gcattttctggaattactgttgcaaaggttttgacccctgacaaatttgtatgtagaaca
gtttgtacttaccgtccaaactgcttattctttacatttttcagcagtgaatgggagata
aaaagccaaaggtatacctgtctgatgatgacttcaagaagtgaaacaccagacagaatt
gcagaaagagcaaatgctatatcaggattcagtctcctgaactgccaaagagctgaacct
gcatgccattcccagacctaccctgaattaaacttccatgggacagaactgagtgtagag
tatgtcgatgggcacaaggcttgtcaagaactttgtacaatgaccctccgctgccaattt
ttcatttacgttttccgtaaaatgcaatgcaaccatgaaggcaaatgtaaatgctactta
agaatgtctgccaatgggtctccagataatatcgaggccaagaatgaaatagtttcaggc
tactctttaaggctgtgccaaactagcagaagccctgtctgtgtgcagaaaccaaagcaa
cagtcaaggattgttggaggctcaaattcttctgttggcgaatggccttggcaagtcagt
ttacatacaaagctctctattcagagccatcattgtggtggttcaatcatcagtgaccaa
tggattttgacggctgcccattgcttagaagacattccgttaactgaacattggcatgtt
tacagcaacattttgaaacagtctgaaataactaatgaaactaccttcttcaaagtccaa
aagatgattattcatcctaggtatgagatttcagaggcaggatatgacattgctttacta
aagcttgatacacctatgaatttcagtgttttacagcaacctgtatgcctgccctcccag
gaagaaatgaacatggcaaaatacactgagtgctgggtgaccggatggggttacacaaaa
gagagaggcacaatcgaagacacgctacaaaaagtcaaaatccccataatgccaaatgca
gaatgtcagtttcaataccctgagcacagaataactgacaagatgttgtgcgccggttac
ccagaagggggcaaggatgcttgccagggagattcaggcggcccaatgtcgtgtaaattc
cagaacagttggtatttggttggcattaccagctggggtgaaggatgtgctcgtccagga
caaccaggagtttacaccaatgtggctaagtttgtagactggattctggaacaaacgtta
gaagattaa

DBGET integrated database retrieval system