KEGG   Python bivittatus (Burmese python): 103052025
Entry
103052025         CDS       T03091                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04012  ErbB signaling pathway
pbi04068  FoxO signaling pathway
pbi04110  Cell cycle
pbi04115  p53 signaling pathway
pbi04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103052025 (CDKN1A)
   04068 FoxO signaling pathway
    103052025 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103052025 (CDKN1A)
   04115 p53 signaling pathway
    103052025 (CDKN1A)
   04218 Cellular senescence
    103052025 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103052025
NCBI-ProteinID: XP_025019018
LinkDB
Position
Unknown
AA seq 149 aa
MPLSESKILQPSCSRKLCRNLFGPVDHEQLQKDFQSLMKVQLEEAQQKWNFDFETETPLE
GNYKWEKVSHLNMLPSPDLLDHTKENSCAGEKSRSSPALFKRHTKTERPGQVGLEARKPD
SPRSLKRKQTSIKDFYSSKRRTIPYKSKP
NT seq 450 nt   +upstreamnt  +downstreamnt
atgcctctttctgagagtaaaatcctacaaccttcctgcagcaggaaactatgcagaaat
ctctttggaccagttgatcatgaacagctccagaaggactttcagtccttgatgaaggtc
cagctggaggaagcccagcaaaagtggaactttgactttgaaacagaaaccccactggaa
gggaattacaaatgggaaaaggtctctcacctaaatatgctgccatcgccagatctctta
gaccacacaaaggagaacagctgtgctggggaaaagagccggagttctccagcacttttc
aagaggcacacgaagacagagagaccagggcaggtgggccttgaagctcgtaagcctgac
tctcccaggtctttgaaaagaaagcagacaagtattaaagacttctacagttcgaagcga
agaactatcccatataagtcaaaaccatga

DBGET integrated database retrieval system