KEGG   Python bivittatus (Burmese python): 103052540Help
Entry
103052540         CDS       T03091                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pbi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103052540 (SUV39H1)
Enzymes [BR:pbi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103052540 (SUV39H1)
Chromosome and associated proteins [BR:pbi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103052540 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    103052540 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 103052540
NCBI-ProteinID: XP_007435438
LinkDB All DBs
Position
Un
AA seq 414 aa AA seqDB search
MAENLKECTVCCKSTWSHLQDLCRLEKVCCPNLGITKKNLSDFEVEYLCDYKKIRDEEFY
LVKWRGYPDSENTWEPRKNLRCISILKQFHRDLEQALIRRGGKLKKNMRLLDQGISNYLV
QKAKQRRALQHWEYELNAKRNHKGRIVVENEVDLDGPPRDFVYINEYKVGEGITLNQVAV
GCECSDCLSEAAGGCCPGASHHKFAYNELGQVKIKAGMPIYECNSRCSCGIDCPNRVVQK
GIRYDLCIFRTDNGRGWGVRTLEKIRKHSFVMEYVGEIITSEEAERRGQIYDRQGATYLF
DLDYVEDVYTVDAAYYGNISHFVNHSCNPNLQVYNVFIENLDERLPRIAFFATRSIRVGE
ELTFDYNMQVDPVNAESTRMDSNFGLVGSLAGSPKKRMRIECKCGTESCRKYLF
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaagagtgtactgtttgctgcaagtcaacctggtcccatctccag
gatctgtgtcgactggagaaagtgtgttgccctaacttgggcattactaaaaaaaacctc
agtgattttgaagtagaatatctatgtgattataagaaaatccgggatgaggaattctac
ctggtgaagtggcggggctatcctgattcagagaacacctgggagccccgaaagaatttg
cgctgtatcagcatactcaaacaattccacagggacctagaacaggcattgatccggcgt
ggtggcaagctcaaaaagaatatgcgcttacttgaccaaggaatttccaactatctggtt
cagaaggccaaacagaggcgagctttgcagcattgggaatatgagctcaatgccaagcgc
aaccacaagggacgaattgtggtagaaaatgaggtggacttggatgggcctccccgggac
tttgtctacatcaatgagtataaagttggggagggtatcactctcaaccaggtggctgtg
ggctgtgaatgctcagactgtctgtcagaagcagcaggaggttgctgtcctggtgcctca
catcataaatttgcctataatgagttgggtcaagtgaagatcaaggctggcatgcccatc
tatgagtgcaattctcgttgcagctgtggcattgattgcccaaatcgtgtagtacagaag
ggcattcgttatgatctttgcattttccggacagataatggacgtggctggggtgtacgt
acattggagaagatccgcaagcacagctttgtcatggaatatgttggagagattatcaca
tcagaggaagctgagcgacggggtcagatctatgaccgacaaggtgccacttatctgttt
gacctggactacgtagaagatgtatacacagtagatgctgcctattacggcaacatttca
cattttgttaatcacagttgcaatcccaaccttcaggtgtacaatgtttttattgaaaat
ttggatgaacggctgccgcgcattgctttctttgctactcgatctatccgagttggtgaa
gagctcacctttgactataatatgcaagtggatccggtaaatgcagaaagcacaaggatg
gactctaattttggcctagttggaagcctggctggctcaccgaagaagcggatgcgaatt
gagtgtaaatgtggcacagagtcttgtcggaaatatcttttctag

DBGET integrated database retrieval system