KEGG   Python bivittatus (Burmese python): 103053360
Entry
103053360         CDS       T03091                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04012  ErbB signaling pathway
pbi04068  FoxO signaling pathway
pbi04110  Cell cycle
pbi04115  p53 signaling pathway
pbi04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103053360
   04068 FoxO signaling pathway
    103053360
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103053360
   04115 p53 signaling pathway
    103053360
   04218 Cellular senescence
    103053360
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103053360
NCBI-ProteinID: XP_007425970
LinkDB
Position
Unknown
AA seq 168 aa
MRSNPDSKASLLDALVLDRQQGGRMELTSAKAAPTRRNLFGPVDHEHLQQEFQSVMSSSM
EGAKQRWNFDFFREVPTAGLLQWEELQGHEVPAFYHPCVAREPRQPLQPVNRTVDRDAKA
PLLAKEVERARPAKKAAAKRRQTYLTDYYTTKKQIRTNMQTPVKKLAF
NT seq 507 nt   +upstreamnt  +downstreamnt
atgcgcagcaaccctgattctaaggcctcgctgcttgacgctctcgtcctcgacaggcag
cagggggggaggatggagctgacctctgccaaagcagcccccacccgcaggaatcttttc
gggccagtggaccacgagcatttgcagcaggagttccagagcgtgatgagctccagcatg
gaaggggcgaagcagcggtggaacttcgacttcttccgggaagtgcccaccgcaggtctt
ctccagtgggaagagctgcagggccatgaggttccggccttctaccacccgtgcgtggcc
agggagcctcgccagcctctgcagcccgtgaacaggactgtggacagagacgcaaaagct
cccctcctcgccaaagaggtcgaaagagccagaccagccaagaaggcggcagcgaagcga
aggcagacgtatttgacggattattatacaacaaagaagcagatcagaacaaatatgcaa
acacctgtaaagaaattggccttctag

DBGET integrated database retrieval system