KEGG   Python bivittatus (Burmese python): 103053675
Entry
103053675         CDS       T03091                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04010  MAPK signaling pathway
pbi04210  Apoptosis
pbi04620  Toll-like receptor signaling pathway
pbi04621  NOD-like receptor signaling pathway
pbi04622  RIG-I-like receptor signaling pathway
pbi04623  Cytosolic DNA-sensing pathway
pbi04625  C-type lectin receptor signaling pathway
pbi04920  Adipocytokine signaling pathway
pbi05132  Salmonella infection
pbi05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103053675 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103053675 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103053675 (IKBKG)
   04621 NOD-like receptor signaling pathway
    103053675 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    103053675 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    103053675 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    103053675 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103053675 (IKBKG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103053675 (IKBKG)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103053675 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pbi01001]
    103053675 (IKBKG)
Protein kinases [BR:pbi01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   103053675 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO ANAPC5
Other DBs
NCBI-GeneID: 103053675
NCBI-ProteinID: XP_007425799
LinkDB
Position
Unknown
AA seq 542 aa
MSIAQGDWSCNMVQPSGCPASDYGMMGDDSSLGKAGTLQLPAELAGHEAVQYFLAENKDL
KEAIRQSNHMLRERYQEFVQFQASKKEEKEFIMSKFQEARLVVEKLHVERMGLEMQLEQA
FQDLERLKTASRPFLSEKDPSGTQEEPDTVTLTEEDVLTVTSGILKQKKERPEEDLKALQ
DANQALQKEKLALQATITTLQRTAKVIVPVEEFRIKIKENGFPSEQSLEVESLQGSGDKD
SVGGKQIEQLQKRLKEAEDESLTLRQQLASSLEEQACRTAREQEIQQQLQTLTKQLEQVG
EDKALAKAQVTSLLGELLESQSRLETCTERNKELEERVRGAGERLQQLEKEAEVRTKQHS
VQVDQLRLQVQNLESALRVERQSATEEKRKLAQVQVAYHQLFQEYDTHIKTSLESEKRSK
GLDLQVAELSQQLQQAEEALVAKQELIDKLKEEAEQHKTIMETVPVLKAQADIFKTDFLA
ERQAREKLHEQRETLVEQVAQLQRENEKLKADSEGVSRALMEEMRNRHSEMRPPPQPRKC
WH
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgagtatagcccagggggactggagctgcaacatggtgcagccaagtgggtgcccagct
agtgactatggcatgatgggagacgactcctctctgggcaaagctggtacccttcagttg
ccagctgagctagcaggacatgaagctgtgcagtatttcctggctgagaacaaagacctc
aaagaagccatccgacaaagtaaccacatgctacgagaacggtaccaggaatttgtacag
ttccaggcttccaaaaaggaggagaaggaattcattatgagcaagttccaggaggctcgg
cttgtggtggaaaagttgcacgtggaacgcatggggttggaaatgcagttggagcaggct
tttcaagatctagagcgactgaagacagcttctcgaccatttctctcagagaaagacccc
tctggcacccaagaggagcctgacactgtgactcttactgaggaagatgtacttactgtg
acatcggggatactaaagcagaaaaaggaaaggccagaagaggacttgaaggcattgcaa
gacgccaaccaggccttacagaaagaaaaacttgccttgcaggccacgatcaccacactg
caacgaactgcaaaggtcattgtgccagtagaagagttcagaataaagattaaagagaat
ggttttccatcggagcagtccctggaagtagagtccctgcagggctcaggggacaaagac
agcgttggtgggaaacaaattgaacagctgcaaaaaagactgaaggaggctgaagatgaa
agcttaacccttcggcaacagctggcatccagtttggaggagcaggcctgccggacggcc
cgggagcaggagatccagcagcagctgcaaactttgaccaaacagctggagcaagttggg
gaggataaggccttagcaaaggcccaggtgacatccctgctgggggagctgctggagagc
caaagccgcctcgaaacttgcacagagcgaaacaaagagctggaggagagggttcgtggg
gctggtgaacgactgcaacagcttgaaaaggaggctgaagtccgcaccaaacagcacagc
gtacaggtggatcagttacggctacaggtgcaaaaccttgagagcgctctgcgagtggaa
cgacagagtgccacagaggaaaagagaaaactagcccaagtgcaggtggcctatcaccaa
ctgttccaagagtatgatacccatatcaagaccagcttggaaagtgagaagcgaagcaag
ggcttggatctgcaggttgctgaactgtctcagcaactgcagcaggctgaagaggctctg
gtggccaagcaagagctcattgacaagctgaaggaggaggctgaacaacacaaaactatt
atggagactgtgcctgtgctcaaggcacaggctgatatcttcaagacagatttcctggca
gagcgccaggctcgtgaaaagctgcatgaacagcgagagaccctggtggaacaagttgca
caattgcagagagagaatgagaagctgaaagctgactctgaaggagtcagccgggctctg
atggaagagatgaggaatcgccattcagaaatgcgtccacctcctcagccacgtaagtgt
tggcactga

DBGET integrated database retrieval system