KEGG   Python bivittatus (Burmese python): 103053682Help
Entry
103053682         CDS       T03091                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7 isoform X4
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
pbi  Python bivittatus (Burmese python)
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pbi03036]
    103053682 (HDAC7)
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103053682 (HDAC7)
Chromosome and associated proteins [BR:pbi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103053682 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 103053682
NCBI-ProteinID: XP_007428424
LinkDB All DBs
Position
Unknown
AA seq 1017 aa AA seqDB search
MANLIWARYSGRCSLNPSRDQQVGEHGGAVKLCVSLQVPQTIPMDLRIGQRLAKPGPDTA
LLALKQTQQLQHQFFLASLHQQQVEQLTRPHLRVPMEPPPQETVPGKQEQELRLLLNKDK
SKRSAVASMVVKQKLAEVILKKQQAALERTNAPIMPYRSLEPMEHEGPPNPVLSTFFPPV
PNNSRDSPEHFPLRKTASEPNLKLRCKAKKTERRKNPLTRKESAPPSLKRRPAEAIDSSP
SSSSTPVSGCSSPNDSLVPEHGALPATPGLVQEAPLAQRLRMQESSLAQYALQTSSSLPA
LTLGLPATSAASVRGDSDHRAHPGLAHKVPVLTSTHAPVFLPASLEQHEPGSPLSPRLHP
VIILEPSLAHPPLVTVPGLGSVPFHFSPSVLPSERLSMPVIHKPLGRTRSEPLPSSPRTV
QQQLAYQQHHTLFLEHLKQQTQLGKRMAKSSEKPRLQQIPSSEDMEAEAGGDPSEQPQGQ
GDPSPAGGSSKEAERTSRLGQQPQEELVLHQAHYVWEQQQRIQQQQLLRRQPAADSLLTP
ATRGGHRPLSRAHSSPAPATACLPSQDTSSKAIPLPVQEQSIKPRFTTGIVYDSVMLKHQ
CSCGDNSNHPEHAGRIQSIWSRLQERGLRNQCECLRGRKATLEELQSVHAERHVLLYGTN
PLSRLKLDNGKLAGILSQRMFVMLPCGGLGVDSDTIWNELHSSNAARWAAGSVTELAFKV
ASRQLKNGFAVVRPPGHHADLSTAMGFCFFNSVAIAARQLQQKGKIGKILIVDWDVHHGN
GTQQVFYRDPNILYISLHRYDNGNFFPGSGAADEVGSGAGEGFTVNVAWTGGLDPPMGDP
EYLAAFRTVVMPIAQEFSPDVVLVSAGFDAADGHPPPLGGYKVSAKCFGYMTRQLMNVAG
GALVLALEGGHDLTAICDASEACVSALLGNELEPLPEETLQQKPSTNAVHSLEAVIQVQS
QYWSSVHRFAPTVGYSILEAQRHDVEEVETVTALASLSVMAEKKRQGEPMEEEPMNQ
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atggccaatctaatttgggctagatattctggaaggtgtagtctcaacccatccagagac
caacaggttggagaacatggaggtgctgtgaagctctgcgtctccttgcaggttccccag
accatccccatggacctgcggattggacagcgtcttgccaaacccggcccagatactgcc
ttattggccctgaagcagacacagcagctgcaacaccagttcttcctagcaagcttgcat
caacagcaagtggaacaacttacccgcccgcacttgcgggtgccgatggagcccccgccc
caagagaccgtccctggaaaacaggaacaggagctgcggctgctcttgaataaagacaaa
agcaaacgcagtgctgtagcaagtatggttgtgaagcagaagctggcagaggtcatcctg
aaaaaacaacaagctgctctggaaaggactaacgctcccatcatgccatacaggtccttg
gagccaatggaacatgaaggaccaccaaatcctgtgctctctactttctttcctcctgtc
cccaacaactccagggattctccagagcactttccactaaggaaaacagcctctgagccc
aacctgaagttgcgctgcaaagctaaaaaaactgaacggcgcaaaaacccactgacccgg
aaggaaagtgcacccccttccttgaaaaggcgcccggcagaagccattgattcatctccc
agcagcagcagcaccccagtctctggatgcagttcgcccaatgacagcctggtgccggaa
catggagccctaccagccacgccagggcttgtgcaagaggccccgctagctcagcgcctg
agaatgcaggaaagctcactggctcaatatgctcttcagaccagtagttctctcccagct
ctcacccttggactaccagccacttctgcagcatctgtcaggggggatagtgatcacagg
gcacacccaggccttgcacacaaggtgcctgtcctgactagcactcacgcgcctgtgttc
ctacctgccagcttggagcaacatgaacccggaagccctctgtcccctcgacttcatcct
gttatcattctggagccctcgcttgctcaccctcctctcgttacagttccagggctggga
tcggtcccttttcacttcagcccttcggtgcttccttcggagcggctgtcgatgccggtg
atccacaagcccttaggacggacccgctcggagcctcttccctccagccccaggacagtg
cagcagcagctggcctaccagcagcaccacactctcttcctggagcatctgaagcagcag
acccaattgggaaagcgcatggccaaatccagcgagaagcctcgactgcagcagatcccc
tcttccgaagacatggaggccgaggcaggaggagatccaagcgagcagccccaaggccag
ggggacccatccccagcaggaggcagcagcaaggaagcagagaggacctccaggttgggc
cagcagcctcaagaggagcttgtccttcatcaggcacattacgtctgggaacaacagcag
cgcatacaacagcaacagctcctccgaaggcagcctgccgctgactcgttgctgacccca
gcgacacggggaggccaccggcccctctccagagctcactcctcacccgccccggccacc
gcctgcctacctagccaggacacgtcttccaaggcaatcccacttccggtgcaagagcag
tccatcaaaccgcgtttcaccacagggatcgtgtatgattctgtcatgctgaaacatcag
tgctcgtgtggagacaacagcaaccatccagagcacgcaggccgcattcagagcatctgg
tctcgcctacaggagcgtggcctacgcaaccagtgcgagtgccttcgaggacgcaaagcc
actttggaggagttgcagtccgttcatgctgagcgtcacgtgctgttgtacgggactaac
cccctcagtcgcctgaagctggacaatgggaaactggcaggaatcctatcccagcgaatg
tttgtcatgctgccctgtggtggacttggggtggacagtgacaccatttggaatgagctg
cactccagcaacgctgcacggtgggcagctggcagtgtgacggagctggccttcaaagtg
gccagtcggcagcttaagaacggcttcgctgtcgtacgacctccaggacaccatgctgat
ctctccacagcaatgggtttctgtttcttcaattcggtggcaattgcagccaggcagctc
caacaaaaagggaaaatcggcaagatactgattgtcgactgggatgttcaccacggtaat
gggacgcagcaggtattctacagagatccgaatatcctctacatctccttgcatcgttat
gacaatggcaacttcttccctgggagcggagcagctgatgaggtgggctccggggctgga
gagggcttcaccgtcaacgtcgcttggacagggggccttgatccccccatgggggatcca
gagtatttggcagctttccggacggtggtgatgcccattgcccaggagttctcgccggat
gtggtgctggtatctgcgggctttgacgcagctgatggccatcctcctccactggggggt
tacaaagtctcagccaaatgttttggttatatgaccaggcagctgatgaatgtggctggt
ggggcccttgttctagccctggaaggaggccatgacctgactgccatttgtgatgcctca
gaggcctgtgtgtctgctctgctgggtaatgagcttgagcctctcccagaagagaccttg
cagcagaaacccagcactaacgctgtgcactccttggaggcagtaatccaggtgcaaagc
cagtactggagctctgtgcatcgttttgcccccactgtggggtactcaattctggaagcc
caacgtcacgacgtggaagaggtggagacagtgaccgcactggcctcactttctgtaatg
gcagaaaaaaagcggcaaggagagccaatggaagaagagcccatgaaccagtga

DBGET integrated database retrieval system