KEGG   Python bivittatus (Burmese python): 103053928
Entry
103053928         CDS       T03091                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04010  MAPK signaling pathway
pbi04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103053928 (TGFA)
   04012 ErbB signaling pathway
    103053928 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 Cadherin_C_2 UPF0560
Other DBs
NCBI-GeneID: 103053928
NCBI-ProteinID: XP_007432149
LinkDB
Position
Unknown
AA seq 157 aa
MASAEVALLTLGVLLAVCHALENTTSALRGPPVAAAVRSHFNNCPDVHSQFCFHGTCRFL
VQEEEPTCVCHSGFIGARCEHADLLAVVAATQKKQTITALVVVSAVASLVVIMVCVLIHC
CRIRKHCEWCRTVVCRHEKPTGLLKGATSCCHSETVV
NT seq 474 nt   +upstreamnt  +downstreamnt
atggccagcgccgaggtcgccctgctcacgctcggtgttttattggcggtgtgccatgcc
ttggagaatacaacatcagccttgaggggtcccccagtggcagctgcagtgagatctcat
tttaacaactgtccagatgtccacagtcagttttgtttccacgggacttgtagattcctg
gtgcaggaagaagaaccgacttgtgtgtgccattctgggttcataggtgcccgctgtgag
cacgccgatctccttgcagtggtggctgccacccagaagaagcaaaccataaccgcctta
gtggtggtttctgccgtcgcctcccttgtcgttatcatggtctgcgtcctgatccattgc
tgcaggatacggaaacactgcgagtggtgcaggactgttgtttgcagacacgagaaaccc
actgggctcctgaagggggctacgtcttgctgccactcagagacagttgtctga

DBGET integrated database retrieval system