KEGG   Python bivittatus (Burmese python): 103053984Help
Entry
103053984         CDS       T03091                                 

Gene name
MAPK6
Definition
(RefSeq) mitogen-activated protein kinase 6 isoform X1
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
pbi  Python bivittatus (Burmese python)
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pbi01001]
    103053984 (MAPK6)
Enzymes [BR:pbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103053984 (MAPK6)
Protein kinases [BR:pbi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103053984 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 103053984
NCBI-ProteinID: XP_007422238
LinkDB All DBs
Position
Unknown
AA seq 718 aa AA seqDB search
MAEKFESLMNIHGFDVGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAVKKIVLSDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPNGSQLTDDVGSLTELNCVYIVQEYMETDLANLVE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLNVIPVYIKNDMTEPHKPLTQLLPGISPEALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPTDEPISSHPFHIEDEVDDILLMDESHSHVYNWERYHDS
QFSDHEWPVHNNFEADEVQRDPRALSDGTDEEEVQVDPRKYLDGDREKYLEDPAFDTHFS
TEPCWQYPDHHENKYCDLECNHTCNYKMRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCEKNGLVKAQIALEEASQQLAEKEKNQGFDFDSFIAGTIQLSLQHE
STAVDKLNDLNSSVSQLESKGISKSVSREKQEKGMANLAQLEALYQNSWDSQLVSGGEEC
FLIDQFCCEVRKDEQMEKENPYPSYLDRFFSKKEDTEMLETEPAEDGKLGEKEREGSFLS
NSGEFLFNKHLEAIAIPQFPSPVGSPLKSLQATLTPSAMKSSPQIPHKTYSSILKHLN
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagtttgaaagtctcatgaacattcatggctttgatgtaggttctcggtat
atggacttaaaacctctgggctgtggtggtaacggcttagttttttctgctgtcgataat
gattgtgacaaaagagtggctgtcaagaagattgtcctttcagatcctcagagtgtcaag
catgctctgcgtgagatcaaaattatcagaagacttgaccatgataacattgtcaaagtt
tttgaaatccttggccccaatgggagtcagttgacagatgatgttggctctctgacagaa
ctgaactgtgtttacattgttcaagagtacatggagacagatctggctaacctggtggag
caggggcccttactggaagaacatgctaggctcttcatgtaccagctgctacgtgggctc
aaatacatccactctgcaaacgttctgcatagagatctcaaaccagcgaacctgttcatt
aatactgaagacttggtgctgaaaatcggtgactttggccttgcacggatcatggaccct
cattattcccataagggccatctttctgaaggactagtgactaaatggtaccgatcccct
cgcctcttgctgtcacccaacaactatactaaagccattgatatgtgggctgcaggttgc
atcttcgctgaaatgctgacagggaaaaccctcttcgcaggtgcccatgaacttgaacag
atgcagctaattttagaatcaattcctgttgtgcatgaagaagaccgtcaggaacttctt
aatgtaatcccagtttacattaaaaatgacatgactgagccacacaaacctttaactcag
ttactcccaggcattagccctgaagctttggacttcttggaacaaatactgacctttagt
cccatggaccgattgacagcagaagaagctttgtcccacccttacatgagtatttattcc
ttcccaactgatgagcctatttcgagtcatcctttccacattgaggatgaagtggatgat
attctgctgatggatgaaagtcacagccacgtctacaattgggaaagatatcatgacagt
cagttttcagaccatgagtggcctgttcataacaactttgaagctgatgaagttcagcga
gatccaagggctctttcggatgggactgatgaggaggaagtacaagtagaccctcgaaaa
tatttggatggcgatcgtgaaaagtatctagaggatccagcttttgatacccacttctct
actgagccttgttggcagtacccagatcaccatgaaaacaagtattgtgatctggaatgt
aaccatacttgtaattacaaaatgaggtcctcttcatatctagataatttagtctggcga
gaaagcgaagtgaaccattactatgagcccaagcttatcatagatctttctaactggaag
gagcagagtaaagagaagtcagataaaaaaggcaagtcaaaatgtgaaaagaatggattg
gtgaaagctcagatagctcttgaggaagcttcacagcaacttgcagaaaaggagaaaaat
caagggtttgactttgattcgttcatagcaggaacaattcagcttagtttgcagcatgag
tcaactgctgttgataagttgaatgacctgaatagctccgtgtcccaactagaatccaaa
ggcatatctaaatcagtaagcagagagaaacaggagaaaggaatggctaacttggcccag
ttggaagctctctaccaaaactcgtgggatagtcaacttgtcagcggtggggaggagtgt
tttctcatagatcagttttgttgtgaagtaaggaaggatgagcagatggagaaagagaat
ccataccccagttatctagacaggttttttagcaagaaagaagacactgaaatgctagaa
actgagccagctgaagatggaaagcttggggagaaagaaagagaggggagctttctgagc
aatagcggagaatttctctttaacaagcaccttgaagctatagctattcctcagtttccc
agcccagttggctcaccacttaaatccttgcaggccacgctaacgccttctgctatgaag
tcatctcctcagatcccccataagacatacagcagcattctgaaacacctaaactaa

DBGET integrated database retrieval system