KEGG   Python bivittatus (Burmese python): 103054965Help
Entry
103054965         CDS       T03091                                 

Definition
(RefSeq) intestinal-type alkaline phosphatase isoform X2
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00730  Thiamine metabolism
pbi00790  Folate biosynthesis
pbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    103054965
   00790 Folate biosynthesis
    103054965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbi04147]
    103054965
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pbi00537]
    103054965
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     103054965
Exosome [BR:pbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103054965
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pbi00537]
 Enzymes
  103054965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 103054965
NCBI-ProteinID: XP_015743663
LinkDB All DBs
Position
Unknown
AA seq 520 aa AA seqDB search
MWRAGLGLWLVGLAFATAVIPVEEEKPSFWNQRAQKAIQKAIRLPFRQYQAKNLIIFLGD
GMGIPTITATRILKGQMQNPPLPETPLSMDMFPYVALSKTYNVDRQVPDSAGTATAYLCG
VKGNFQTIGVSAAARYNQCNTTAGNEVISVLKRAQMAGKSVGIVTTTRVQHASPAGNYAH
VVNRNWYSDAAMPKPALAGGCKDIAVQLIENVDLTVVLGGGRKYMTPKGTPDPEYPTSSA
ANGTRNDNRNLIEEWLKAFPGRKYVWNRAELLKAVTDPTVERLMGLFEPGDMKYELNRDN
STDPSLAEMTEVAINLLSSNPKGFYLFVEGGKIDLGHHEGIAKRALTEAIEFDKAIQRAG
ELTQEDDTLTVVTADHSHVFSFGGYTLRGTSIYGLAPEKAADGKSYTSIVYGNGPGFQVS
KEGRPNVNIEESENNTYHQQAAVPLVSETHGGEDVAIMAKGPMAHLFHGVQEQSYIAHVM
AYAAGLEPYTPKKLSGGNSAAAPKSSIAGLLLVPLLLWIC
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgggcagggctgggtctgtggctggtggggctggcgttcgccactgcagtcatc
ccagtggaagaggagaaaccatcgttctggaatcaacgggcacaaaaggccattcagaaa
gccatccgtctgccattccgccaataccaggccaagaacctcatcatctttctgggagat
gggatgggcattcccaccatcaccgctacccgcatcctgaaggggcagatgcaaaacccg
ccacttcctgaaacacctctaagcatggacatgtttccgtatgtggctctctccaagacc
tacaacgtggaccgacaagtgcccgacagcgcgggaaccgccactgcctacctctgtggg
gtgaagggcaactttcaaaccattggcgtgagtgccgctgcccggtataatcagtgcaat
acaacagcgggcaacgaagtcatttctgtcctgaagcgggctcagatggctggaaagtcg
gtggggattgtgaccaccacgcgagtccagcatgcctccccggccggcaactatgcccac
gttgtgaaccgaaactggtatagcgatgctgccatgcctaaaccagcgctcgcaggcggc
tgcaaggatatcgcggtgcagctcattgaaaacgtggacctcacggtggtcctgggtggg
ggcaggaaatatatgactcctaagggcaccccagaccctgagtaccccaccagcagtgca
gccaacgggacccgtaacgataacagaaaccttattgaggaatggctgaaagcttttcca
ggcaggaagtacgtctggaaccgagccgagctattgaaagctgtcactgacccgacggtg
gagcgcctcatgggcctctttgaaccaggagacatgaagtacgagctgaaccgggacaac
agcactgacccatctctggccgagatgaccgaagtggccatcaacttgctcagttccaac
cccaaaggcttctatctctttgttgaaggaggcaagattgacttagggcatcacgaaggt
attgctaagcgagccctgacggaggcgattgagtttgataaagccatccagcgagccggg
gagttgactcaggaagatgacactctgactgttgtgaccgctgaccactcccacgtcttc
agcttcggaggctacactctccgggggacctccatttatgggttggcacctgaaaaggca
gcggatggcaagtcatacacctctattgtttatggcaacgggccaggcttccaggtctcc
aaagaaggccgaccgaacgtaaacatagaagaaagtgagaacaacacgtaccaccagcag
gctgccgtgccccttgtctcagagacccatgggggtgaggacgtggccatcatggccaag
ggacctatggcccacctcttccacggggtgcaggaacaatcgtacatcgctcacgtcatg
gcctacgccgccggcttggagccctacacgccgaagaagttgtccggtggcaactctgca
gctgcgcccaagtccagcattgcgggtctcctcctggttcctctgctcctgtggatctgc
tag

DBGET integrated database retrieval system