KEGG   Python bivittatus (Burmese python): 103055336Help
Entry
103055336         CDS       T03091                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00020  Citrate cycle (TCA cycle)
pbi00190  Oxidative phosphorylation
pbi01100  Metabolic pathways
pbi01200  Carbon metabolism
Module
pbi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pbi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pbi_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103055336
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103055336
Enzymes [BR:pbi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103055336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-GeneID: 103055336
NCBI-ProteinID: XP_007441616
LinkDB All DBs
Position
Unknown
AA seq 439 aa AA seqDB search
MENGECCGIIALCIEDGTIHRFRAKNTVIATGGYGRTYFSCTSAHTCTGDGTAMATRAGL
PCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSEGERFMERYAPVAKDLASRDVVSR
SMTIEIREGRGCGPDRDHVYLQLHHLPPQQLAMRLPGISETAMIFAGVDVTKEPIPVLPT
VHYNMGGIPTNYKGQVITHINGKDQIVPGLYACGEAASASVHGANRLGANSLLDLIVFGR
ACALTIAESCKPGESVPSIKSNAGEESVANLDKLRFANGNVRTSELRLNMQKTMQSHAAV
FRIGPVLQEGCEKMSRLYKDFDVLKTFDRGVIWNTDLVESLELQNLMLCALQTIYGAEAR
KESRGAHAREDYKVRIDEYDYSKPAQGQQKKSFEQHWRKHTLSYVDVKTGKVTLNYRPVI
DKTLNEEDCATVPPAIRSY
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatggagaatgttgtggtattattgcactctgtatagaagatggcacaatccat
cgtttcagagcaaagaatacagttattgccactggaggatatggacgcacatattttagc
tgtacttctgctcacacttgcactggagatggcacagcaatggctactcgggcaggtcta
ccttgccaggatttggaatttgtgcagttccatcccacaggtatttatggagctggctgt
cttattacagaaggctgtcgtggtgaaggaggtattttaattaacagtgaaggagaaagg
tttatggagagatatgctccagttgccaaagatctagcttcccgggatgttgtgtctcgt
tctatgactattgagatccgtgaaggaagaggttgtggacctgacagagatcatgtgtac
ttgcaattgcaccatttgccaccacagcaactagcaatgcgtcttcctgggatttcagaa
actgctatgatatttgctggtgtggatgtcacaaaagagcctattcctgtcctacctact
gtgcattacaatatgggaggtatccctacaaactacaaaggacaggtaattacacatatc
aatggcaaagatcaaatagtacctggcttatacgcttgtggtgaagcagcttctgcctct
gtccatggtgctaatcgacttggtgcaaactcccttttggacttgatagtctttggtcgt
gcctgtgctcttaccattgcagaatcatgcaaacctggagaatcagttccatcaattaaa
tcaaatgcaggtgaagaatctgttgcaaaccttgacaaactgcgctttgccaatggaaat
gtaagaacatcagaactgagacttaatatgcaaaaaacaatgcaaagccatgctgccgtg
ttccgtataggtcctgtcttacaagaaggctgtgaaaaaatgtccagactctataaagat
tttgatgttctgaagacatttgatagaggtgttatttggaatactgacttagtggaaagt
ttggaactacaaaatttgatgctctgtgctttacaaactatttatggtgcagaagctcgg
aaagagtcacgtggagctcatgctagggaagattataaggttaggatagatgaatatgat
tattctaaaccagcccaaggacagcagaagaaatcatttgagcagcattggagaaaacat
actctctcttatgtagatgtgaagactgggaaggttaccctgaattatagacctgtaatt
gataaaaccctgaatgaagaagattgtgctacagttccaccagctattcgctcttattag

DBGET integrated database retrieval system